260860

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 17665..18575 Replicon plasmid unnamed1
Accession NZ_CP107346
Organism Klebsiella pneumoniae strain CRKP_36

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag OH497_RS27025 Protein ID WP_004026354.1
Coordinates 18105..18575 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag OH497_RS27020 Protein ID WP_004026357.1
Coordinates 17665..18108 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH497_RS26990 12700..13101 + 402 WP_214588034.1 LuxR C-terminal-related transcriptional regulator -
OH497_RS26995 13174..14076 + 903 WP_004213613.1 DMT family inner membrane transporter PEG344 -
OH497_RS27000 14219..14440 - 222 WP_004213615.1 hypothetical protein -
OH497_RS27005 14502..15809 - 1308 Protein_20 FepA family TonB-dependent siderophore receptor -
OH497_RS27010 15875..16855 + 981 WP_000019473.1 IS5-like element ISKpn26 family transposase -
OH497_RS27015 17061..17564 + 504 Protein_22 DUF4113 domain-containing protein -
OH497_RS27020 17665..18108 + 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
OH497_RS27025 18105..18575 + 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
OH497_RS27030 18724..19421 + 698 WP_223175001.1 IS1-like element IS1A family transposase -
OH497_RS27035 19423..19872 + 450 WP_011251283.1 thioredoxin fold domain-containing protein -
OH497_RS27040 19889..20200 + 312 WP_011251282.1 hypothetical protein -
OH497_RS27045 20214..20555 + 342 WP_011251281.1 hypothetical protein -
OH497_RS27050 20615..21571 + 957 WP_011251280.1 DsbA family protein -
OH497_RS27055 21996..22436 - 441 WP_011251275.1 hypothetical protein -
OH497_RS27060 22442..22936 - 495 WP_011251274.1 hypothetical protein -
OH497_RS27065 22945..23259 - 315 WP_011251273.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA / iroN / rmpA2 / iutA / iucD / iucC / iucB / iucA 1..193834 193834
- inside IScluster/Tn - rmpA / iroN 4880..24856 19976


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T260860 WP_004026354.1 NZ_CP107346:18105-18575 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT260860 WP_004026357.1 NZ_CP107346:17665-18108 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References