Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | /RES-TIGR02293 |
| Location | 17665..18575 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107346 | ||
| Organism | Klebsiella pneumoniae strain CRKP_36 | ||
Toxin (Protein)
| Gene name | - | Uniprot ID | A0A663AYG0 |
| Locus tag | OH497_RS27025 | Protein ID | WP_004026354.1 |
| Coordinates | 18105..18575 (+) | Length | 157 a.a. |
Antitoxin (Protein)
| Gene name | - | Uniprot ID | A0A6P1V3Q9 |
| Locus tag | OH497_RS27020 | Protein ID | WP_004026357.1 |
| Coordinates | 17665..18108 (+) | Length | 148 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH497_RS26990 | 12700..13101 | + | 402 | WP_214588034.1 | LuxR C-terminal-related transcriptional regulator | - |
| OH497_RS26995 | 13174..14076 | + | 903 | WP_004213613.1 | DMT family inner membrane transporter PEG344 | - |
| OH497_RS27000 | 14219..14440 | - | 222 | WP_004213615.1 | hypothetical protein | - |
| OH497_RS27005 | 14502..15809 | - | 1308 | Protein_20 | FepA family TonB-dependent siderophore receptor | - |
| OH497_RS27010 | 15875..16855 | + | 981 | WP_000019473.1 | IS5-like element ISKpn26 family transposase | - |
| OH497_RS27015 | 17061..17564 | + | 504 | Protein_22 | DUF4113 domain-containing protein | - |
| OH497_RS27020 | 17665..18108 | + | 444 | WP_004026357.1 | DUF2384 domain-containing protein | Antitoxin |
| OH497_RS27025 | 18105..18575 | + | 471 | WP_004026354.1 | RES family NAD+ phosphorylase | Toxin |
| OH497_RS27030 | 18724..19421 | + | 698 | WP_223175001.1 | IS1-like element IS1A family transposase | - |
| OH497_RS27035 | 19423..19872 | + | 450 | WP_011251283.1 | thioredoxin fold domain-containing protein | - |
| OH497_RS27040 | 19889..20200 | + | 312 | WP_011251282.1 | hypothetical protein | - |
| OH497_RS27045 | 20214..20555 | + | 342 | WP_011251281.1 | hypothetical protein | - |
| OH497_RS27050 | 20615..21571 | + | 957 | WP_011251280.1 | DsbA family protein | - |
| OH497_RS27055 | 21996..22436 | - | 441 | WP_011251275.1 | hypothetical protein | - |
| OH497_RS27060 | 22442..22936 | - | 495 | WP_011251274.1 | hypothetical protein | - |
| OH497_RS27065 | 22945..23259 | - | 315 | WP_011251273.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | rmpA / iroN / rmpA2 / iutA / iucD / iucC / iucB / iucA | 1..193834 | 193834 | |
| - | inside | IScluster/Tn | - | rmpA / iroN | 4880..24856 | 19976 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 157 a.a. Molecular weight: 17515.79 Da Isoelectric Point: 4.6155
>T260860 WP_004026354.1 NZ_CP107346:18105-18575 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK
Download Length: 471 bp
Antitoxin
Download Length: 148 a.a. Molecular weight: 16480.80 Da Isoelectric Point: 10.2498
>AT260860 WP_004026357.1 NZ_CP107346:17665-18108 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS
Download Length: 444 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A663AYG0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A6P1V3Q9 |