Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 57982..58625 | Replicon | plasmid unnamed1 |
Accession | NZ_CP107342 | ||
Organism | Klebsiella pneumoniae strain CRKP_37 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | OH503_RS28230 | Protein ID | WP_001044770.1 |
Coordinates | 57982..58398 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | OH503_RS28235 | Protein ID | WP_001261282.1 |
Coordinates | 58395..58625 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH503_RS28210 (54085) | 54085..54357 | - | 273 | Protein_81 | transposase | - |
OH503_RS28220 (55339) | 55339..56361 | - | 1023 | WP_000361404.1 | helicase UvrD | - |
OH503_RS28225 (56346) | 56346..57908 | - | 1563 | WP_004206609.1 | AAA family ATPase | - |
OH503_RS28230 (57982) | 57982..58398 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OH503_RS28235 (58395) | 58395..58625 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OH503_RS28240 (58582) | 58582..59043 | + | 462 | WP_014343465.1 | hypothetical protein | - |
OH503_RS28245 (59204) | 59204..60148 | + | 945 | WP_011977810.1 | hypothetical protein | - |
OH503_RS28250 (60185) | 60185..60577 | + | 393 | WP_011977811.1 | hypothetical protein | - |
OH503_RS28255 (60635) | 60635..61156 | + | 522 | WP_013214008.1 | hypothetical protein | - |
OH503_RS28260 (61202) | 61202..61405 | + | 204 | WP_011977813.1 | hypothetical protein | - |
OH503_RS28265 (61435) | 61435..62439 | + | 1005 | WP_011977814.1 | hypothetical protein | - |
OH503_RS28270 (62623) | 62623..63402 | + | 780 | WP_013214009.1 | site-specific integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaKPC-2 | - | 1..88043 | 88043 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T260843 WP_001044770.1 NZ_CP107342:c58398-57982 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |