Detailed information of TA system
Overview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3671709..3672363 | Replicon | chromosome |
Accession | NZ_CP107341 | ||
Organism | Klebsiella pneumoniae strain CRKP_37 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | R4YHX2 |
Locus tag | OH503_RS18260 | Protein ID | WP_004144731.1 |
Coordinates | 3671956..3672363 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | OH503_RS18255 | Protein ID | WP_002916312.1 |
Coordinates | 3671709..3671975 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH503_RS18230 (3666865) | 3666865..3668298 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
OH503_RS18235 (3668417) | 3668417..3669145 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
OH503_RS18240 (3669195) | 3669195..3669506 | + | 312 | WP_002916319.1 | N(4)-acetylcytidine aminohydrolase | - |
OH503_RS18245 (3669670) | 3669670..3670329 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
OH503_RS18250 (3670480) | 3670480..3671463 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
OH503_RS18255 (3671709) | 3671709..3671975 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
OH503_RS18260 (3671956) | 3671956..3672363 | + | 408 | WP_004144731.1 | protein YgfX | Toxin |
OH503_RS18265 (3672370) | 3672370..3672891 | - | 522 | WP_002916308.1 | flavodoxin FldB | - |
OH503_RS18270 (3672992) | 3672992..3673888 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
OH503_RS18275 (3673911) | 3673911..3674624 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OH503_RS18280 (3674630) | 3674630..3676363 | + | 1734 | WP_004151783.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15936.69 Da Isoelectric Point: 11.4778
>T260836 WP_004144731.1 NZ_CP107341:3671956-3672363 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNAE
WEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNAE
WEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A378E4P6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |