Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 1438640..1439259 Replicon chromosome
Accession NZ_CP107341
Organism Klebsiella pneumoniae strain CRKP_37

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OH503_RS07215 Protein ID WP_002892050.1
Coordinates 1439041..1439259 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OH503_RS07210 Protein ID WP_002892066.1
Coordinates 1438640..1439014 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH503_RS07200 (1433792) 1433792..1434985 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OH503_RS07205 (1435008) 1435008..1438154 + 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
OH503_RS07210 (1438640) 1438640..1439014 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OH503_RS07215 (1439041) 1439041..1439259 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OH503_RS07220 (1439418) 1439418..1439984 + 567 WP_002892030.1 maltose O-acetyltransferase -
OH503_RS07225 (1439956) 1439956..1440096 - 141 WP_004147370.1 hypothetical protein -
OH503_RS07230 (1440117) 1440117..1440587 + 471 WP_002892026.1 YlaC family protein -
OH503_RS07235 (1440562) 1440562..1442013 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
OH503_RS07240 (1442114) 1442114..1442812 + 699 WP_002892021.1 GNAT family protein -
OH503_RS07245 (1442809) 1442809..1442949 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OH503_RS07250 (1442949) 1442949..1443212 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T260829 WP_002892050.1 NZ_CP107341:1439041-1439259 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT260829 WP_002892066.1 NZ_CP107341:1438640-1439014 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References