Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 1438640..1439259 | Replicon | chromosome |
Accession | NZ_CP107341 | ||
Organism | Klebsiella pneumoniae strain CRKP_37 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | OH503_RS07215 | Protein ID | WP_002892050.1 |
Coordinates | 1439041..1439259 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | OH503_RS07210 | Protein ID | WP_002892066.1 |
Coordinates | 1438640..1439014 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH503_RS07200 (1433792) | 1433792..1434985 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
OH503_RS07205 (1435008) | 1435008..1438154 | + | 3147 | WP_020326861.1 | multidrug efflux RND transporter permease subunit AcrB | - |
OH503_RS07210 (1438640) | 1438640..1439014 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
OH503_RS07215 (1439041) | 1439041..1439259 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
OH503_RS07220 (1439418) | 1439418..1439984 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
OH503_RS07225 (1439956) | 1439956..1440096 | - | 141 | WP_004147370.1 | hypothetical protein | - |
OH503_RS07230 (1440117) | 1440117..1440587 | + | 471 | WP_002892026.1 | YlaC family protein | - |
OH503_RS07235 (1440562) | 1440562..1442013 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
OH503_RS07240 (1442114) | 1442114..1442812 | + | 699 | WP_002892021.1 | GNAT family protein | - |
OH503_RS07245 (1442809) | 1442809..1442949 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
OH503_RS07250 (1442949) | 1442949..1443212 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T260829 WP_002892050.1 NZ_CP107341:1439041-1439259 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT260829 WP_002892066.1 NZ_CP107341:1438640-1439014 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |