Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relB-parE/ParE-RHH |
Location | 1696..2276 | Replicon | plasmid unnamed5 |
Accession | NZ_CP107332 | ||
Organism | Klebsiella pneumoniae strain CRKP_39 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A8J3DTL7 |
Locus tag | OH536_RS29920 | Protein ID | WP_071177730.1 |
Coordinates | 1962..2276 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | A0A2X1PRM1 |
Locus tag | OH536_RS29915 | Protein ID | WP_000093040.1 |
Coordinates | 1696..1974 (+) | Length | 93 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH536_RS29900 | 269..514 | + | 246 | WP_032440458.1 | hypothetical protein | - |
OH536_RS29905 | 788..1159 | + | 372 | WP_001237044.1 | cell envelope integrity protein TolA | - |
OH536_RS29910 | 1156..1521 | + | 366 | WP_072354022.1 | TonB family protein | - |
OH536_RS29915 | 1696..1974 | + | 279 | WP_000093040.1 | CopG family ribbon-helix-helix protein | Antitoxin |
OH536_RS29920 | 1962..2276 | + | 315 | WP_071177730.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OH536_RS29925 | 2440..2868 | + | 429 | WP_001140599.1 | hypothetical protein | - |
OH536_RS29930 | 2894..3073 | + | 180 | WP_000165970.1 | Rop family plasmid primer RNA-binding protein | - |
OH536_RS29935 | 3100..3630 | - | 531 | WP_071177729.1 | hypothetical protein | - |
OH536_RS29940 | 3637..4368 | - | 732 | WP_071177728.1 | MobC family replication-relaxation protein | - |
OH536_RS29945 | 4368..6332 | - | 1965 | WP_071177727.1 | TraM recognition domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..11940 | 11940 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11805.73 Da Isoelectric Point: 9.8324
>T260801 WP_071177730.1 NZ_CP107332:1962-2276 [Klebsiella pneumoniae]
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
MPQVTISALAQRDLQRLQDFLKTKNRLAARKGGEVIVRAIQQLKTLPDIGRPVPFLPLEYKELVIGFGDSGYVMLYRHDR
EMDQIVIVTVRHQKESGYPGADSL
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|