Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 77709..78352 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107328 | ||
| Organism | Klebsiella pneumoniae strain CRKP_39 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | OH536_RS27370 | Protein ID | WP_001044770.1 |
| Coordinates | 77709..78125 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | OH536_RS27375 | Protein ID | WP_001261282.1 |
| Coordinates | 78122..78352 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH536_RS27350 | 73812..74084 | - | 273 | Protein_87 | transposase | - |
| OH536_RS27360 | 75066..76088 | - | 1023 | WP_000361404.1 | helicase UvrD | - |
| OH536_RS27365 | 76073..77635 | - | 1563 | WP_004206609.1 | AAA family ATPase | - |
| OH536_RS27370 | 77709..78125 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OH536_RS27375 | 78122..78352 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OH536_RS27380 | 78309..78725 | + | 417 | WP_164481821.1 | hypothetical protein | - |
| OH536_RS27385 | 79270..80091 | + | 822 | WP_004213562.1 | hypothetical protein | - |
| OH536_RS27390 | 80088..80867 | + | 780 | WP_004213560.1 | site-specific integrase | - |
| OH536_RS27395 | 81012..81941 | - | 930 | WP_004213558.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
| OH536_RS27400 | 82245..82412 | + | 168 | Protein_97 | IS1 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | rmpA / iroN / rmpA2 / iutA / iucD / iucC / iucB / iucA | 1..193827 | 193827 | |
| - | inside | IScluster/Tn | - | - | 54660..74490 | 19830 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T260792 WP_001044770.1 NZ_CP107328:c78125-77709 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |