Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 171668..172338 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107321 | ||
| Organism | Klebsiella pneumoniae strain CRKP_40 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q6U619 |
| Locus tag | OH527_RS27885 | Protein ID | WP_004213072.1 |
| Coordinates | 171895..172338 (+) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q6U620 |
| Locus tag | OH527_RS27880 | Protein ID | WP_004213073.1 |
| Coordinates | 171668..171898 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH527_RS27855 | 167891..168790 | - | 900 | WP_004225022.1 | nucleotide-binding protein | - |
| OH527_RS27860 | 168780..169070 | - | 291 | WP_004213078.1 | hypothetical protein | - |
| OH527_RS27865 | 169422..169628 | + | 207 | WP_004213077.1 | hypothetical protein | - |
| OH527_RS27870 | 169618..169911 | - | 294 | WP_004213076.1 | hypothetical protein | - |
| OH527_RS27875 | 169927..171060 | - | 1134 | WP_004213075.1 | DUF3800 domain-containing protein | - |
| OH527_RS27880 | 171668..171898 | + | 231 | WP_004213073.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OH527_RS27885 | 171895..172338 | + | 444 | WP_004213072.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OH527_RS27890 | 172487..172738 | + | 252 | WP_186987481.1 | hypothetical protein | - |
| OH527_RS27895 | 172761..173065 | - | 305 | Protein_196 | transposase | - |
| OH527_RS27900 | 173482..174117 | + | 636 | Protein_197 | mucoid phenotype regulator RmpA2 | - |
| OH527_RS27905 | 174635..175038 | - | 404 | Protein_198 | GAF domain-containing protein | - |
| OH527_RS27910 | 175129..176049 | - | 921 | WP_004213934.1 | DUF1471 domain-containing protein | - |
| OH527_RS27915 | 176098..176589 | - | 492 | WP_011251327.1 | DM13 domain-containing protein | - |
| OH527_RS27920 | 176652..176927 | - | 276 | WP_004213932.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | rmpA / rmpA / iroN / rmpA2 / iutA / iucD / iucC / iucB / iucA | 1..193826 | 193826 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16006.74 Da Isoelectric Point: 9.3642
>T260766 WP_004213072.1 NZ_CP107321:171895-172338 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|