Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 41789..42459 | Replicon | plasmid unnamed2 |
Accession | NZ_CP107314 | ||
Organism | Klebsiella pneumoniae strain CRKP_41 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | Q6U619 |
Locus tag | OH506_RS28565 | Protein ID | WP_004213072.1 |
Coordinates | 41789..42232 (-) | Length | 148 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | Q6U620 |
Locus tag | OH506_RS28570 | Protein ID | WP_004213073.1 |
Coordinates | 42229..42459 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH506_RS28530 | 37200..37475 | + | 276 | WP_004213932.1 | carboxymuconolactone decarboxylase family protein | - |
OH506_RS28535 | 37538..38029 | + | 492 | WP_011251327.1 | DM13 domain-containing protein | - |
OH506_RS28540 | 38078..38998 | + | 921 | WP_004213934.1 | DUF1471 domain-containing protein | - |
OH506_RS28545 | 39089..39492 | + | 404 | Protein_46 | GAF domain-containing protein | - |
OH506_RS28550 | 40010..40645 | - | 636 | Protein_47 | mucoid phenotype regulator RmpA2 | - |
OH506_RS28555 | 41062..41366 | + | 305 | Protein_48 | transposase | - |
OH506_RS28560 | 41389..41640 | - | 252 | WP_186987481.1 | hypothetical protein | - |
OH506_RS28565 | 41789..42232 | - | 444 | WP_004213072.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OH506_RS28570 | 42229..42459 | - | 231 | WP_004213073.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OH506_RS28575 | 43067..44200 | + | 1134 | WP_004213075.1 | DUF3800 domain-containing protein | - |
OH506_RS28580 | 44216..44509 | + | 294 | WP_004213076.1 | hypothetical protein | - |
OH506_RS28585 | 44499..44705 | - | 207 | WP_004213077.1 | hypothetical protein | - |
OH506_RS28590 | 45677..46498 | + | 822 | WP_004213562.1 | hypothetical protein | - |
OH506_RS28595 | 46495..47274 | + | 780 | WP_004213560.1 | site-specific integrase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 | 1..126785 | 126785 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16006.74 Da Isoelectric Point: 9.3642
>T260745 WP_004213072.1 NZ_CP107314:c42232-41789 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|