260745

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 41789..42459 Replicon plasmid unnamed2
Accession NZ_CP107314
Organism Klebsiella pneumoniae strain CRKP_41

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag OH506_RS28565 Protein ID WP_004213072.1
Coordinates 41789..42232 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag OH506_RS28570 Protein ID WP_004213073.1
Coordinates 42229..42459 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH506_RS28530 37200..37475 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
OH506_RS28535 37538..38029 + 492 WP_011251327.1 DM13 domain-containing protein -
OH506_RS28540 38078..38998 + 921 WP_004213934.1 DUF1471 domain-containing protein -
OH506_RS28545 39089..39492 + 404 Protein_46 GAF domain-containing protein -
OH506_RS28550 40010..40645 - 636 Protein_47 mucoid phenotype regulator RmpA2 -
OH506_RS28555 41062..41366 + 305 Protein_48 transposase -
OH506_RS28560 41389..41640 - 252 WP_186987481.1 hypothetical protein -
OH506_RS28565 41789..42232 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
OH506_RS28570 42229..42459 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OH506_RS28575 43067..44200 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
OH506_RS28580 44216..44509 + 294 WP_004213076.1 hypothetical protein -
OH506_RS28585 44499..44705 - 207 WP_004213077.1 hypothetical protein -
OH506_RS28590 45677..46498 + 822 WP_004213562.1 hypothetical protein -
OH506_RS28595 46495..47274 + 780 WP_004213560.1 site-specific integrase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 1..126785 126785


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T260745 WP_004213072.1 NZ_CP107314:c42232-41789 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT260745 WP_004213073.1 NZ_CP107314:c42459-42229 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References