Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 120156..120799 Replicon plasmid unnamed1
Accession NZ_CP107313
Organism Klebsiella pneumoniae strain CRKP_41

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag OH506_RS28160 Protein ID WP_001044770.1
Coordinates 120383..120799 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag OH506_RS28155 Protein ID WP_001261282.1
Coordinates 120156..120386 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH506_RS28120 (115379) 115379..116158 - 780 WP_013214009.1 site-specific integrase -
OH506_RS28125 (116342) 116342..117346 - 1005 WP_011977814.1 hypothetical protein -
OH506_RS28130 (117376) 117376..117579 - 204 WP_011977813.1 hypothetical protein -
OH506_RS28135 (117625) 117625..118146 - 522 WP_013214008.1 hypothetical protein -
OH506_RS28140 (118204) 118204..118596 - 393 WP_011977811.1 hypothetical protein -
OH506_RS28145 (118633) 118633..119577 - 945 WP_011977810.1 hypothetical protein -
OH506_RS28150 (119738) 119738..120199 - 462 WP_014343465.1 hypothetical protein -
OH506_RS28155 (120156) 120156..120386 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OH506_RS28160 (120383) 120383..120799 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
OH506_RS28165 (120873) 120873..122435 + 1563 WP_004206609.1 AAA family ATPase -
OH506_RS28170 (122420) 122420..123442 + 1023 WP_000361404.1 helicase UvrD -
OH506_RS28175 (123698) 123698..124395 + 698 WP_223174630.1 IS1 family transposase -
OH506_RS28180 (124424) 124424..124696 + 273 Protein_168 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid rmtB / blaTEM-1B / blaCTX-M-65 / blaKPC-2 / blaSHV-12 - 1..146891 146891


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T260743 WP_001044770.1 NZ_CP107313:120383-120799 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT260743 WP_001261282.1 NZ_CP107313:120156-120386 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References