Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 120156..120799 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107313 | ||
| Organism | Klebsiella pneumoniae strain CRKP_41 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | OH506_RS28160 | Protein ID | WP_001044770.1 |
| Coordinates | 120383..120799 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | OH506_RS28155 | Protein ID | WP_001261282.1 |
| Coordinates | 120156..120386 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH506_RS28120 (115379) | 115379..116158 | - | 780 | WP_013214009.1 | site-specific integrase | - |
| OH506_RS28125 (116342) | 116342..117346 | - | 1005 | WP_011977814.1 | hypothetical protein | - |
| OH506_RS28130 (117376) | 117376..117579 | - | 204 | WP_011977813.1 | hypothetical protein | - |
| OH506_RS28135 (117625) | 117625..118146 | - | 522 | WP_013214008.1 | hypothetical protein | - |
| OH506_RS28140 (118204) | 118204..118596 | - | 393 | WP_011977811.1 | hypothetical protein | - |
| OH506_RS28145 (118633) | 118633..119577 | - | 945 | WP_011977810.1 | hypothetical protein | - |
| OH506_RS28150 (119738) | 119738..120199 | - | 462 | WP_014343465.1 | hypothetical protein | - |
| OH506_RS28155 (120156) | 120156..120386 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OH506_RS28160 (120383) | 120383..120799 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OH506_RS28165 (120873) | 120873..122435 | + | 1563 | WP_004206609.1 | AAA family ATPase | - |
| OH506_RS28170 (122420) | 122420..123442 | + | 1023 | WP_000361404.1 | helicase UvrD | - |
| OH506_RS28175 (123698) | 123698..124395 | + | 698 | WP_223174630.1 | IS1 family transposase | - |
| OH506_RS28180 (124424) | 124424..124696 | + | 273 | Protein_168 | transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | rmtB / blaTEM-1B / blaCTX-M-65 / blaKPC-2 / blaSHV-12 | - | 1..146891 | 146891 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T260743 WP_001044770.1 NZ_CP107313:120383-120799 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |