Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 65386..66029 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107304 | ||
| Organism | Klebsiella pneumoniae strain CRKP_43 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | OH504_RS27385 | Protein ID | WP_001044770.1 |
| Coordinates | 65386..65802 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | OH504_RS27390 | Protein ID | WP_001261282.1 |
| Coordinates | 65799..66029 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH504_RS27365 (61489) | 61489..61761 | - | 273 | Protein_84 | transposase | - |
| OH504_RS27375 (62743) | 62743..63765 | - | 1023 | WP_000361404.1 | helicase UvrD | - |
| OH504_RS27380 (63750) | 63750..65312 | - | 1563 | WP_004206609.1 | AAA family ATPase | - |
| OH504_RS27385 (65386) | 65386..65802 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OH504_RS27390 (65799) | 65799..66029 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OH504_RS27395 (65986) | 65986..66447 | + | 462 | WP_014343465.1 | hypothetical protein | - |
| OH504_RS27400 (66608) | 66608..67552 | + | 945 | WP_011977810.1 | hypothetical protein | - |
| OH504_RS27405 (67589) | 67589..67981 | + | 393 | WP_011977811.1 | hypothetical protein | - |
| OH504_RS27410 (68039) | 68039..68560 | + | 522 | WP_013214008.1 | hypothetical protein | - |
| OH504_RS27415 (68606) | 68606..68809 | + | 204 | WP_011977813.1 | hypothetical protein | - |
| OH504_RS27420 (68839) | 68839..69843 | + | 1005 | WP_011977814.1 | hypothetical protein | - |
| OH504_RS27425 (70027) | 70027..70806 | + | 780 | WP_013214009.1 | site-specific integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | rmtB / blaTEM-1B / blaCTX-M-65 / blaKPC-2 | - | 1..103669 | 103669 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T260698 WP_001044770.1 NZ_CP107304:c65802-65386 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |