Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4004685..4005304 Replicon chromosome
Accession NZ_CP107303
Organism Klebsiella pneumoniae strain CRKP_43

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OH504_RS19645 Protein ID WP_002892050.1
Coordinates 4004685..4004903 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OH504_RS19650 Protein ID WP_002892066.1
Coordinates 4004930..4005304 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH504_RS19610 4000732..4000995 + 264 WP_002892011.1 type B 50S ribosomal protein L31 -
OH504_RS19615 4000995..4001135 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OH504_RS19620 4001132..4001830 - 699 WP_002892021.1 GNAT family protein -
OH504_RS19625 4001931..4003382 + 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
OH504_RS19630 4003357..4003827 - 471 WP_002892026.1 YlaC family protein -
OH504_RS19635 4003848..4003988 + 141 WP_004147370.1 hypothetical protein -
OH504_RS19640 4003960..4004526 - 567 WP_002892030.1 maltose O-acetyltransferase -
OH504_RS19645 4004685..4004903 - 219 WP_002892050.1 HHA domain-containing protein Toxin
OH504_RS19650 4004930..4005304 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OH504_RS19655 4005790..4008936 - 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
OH504_RS19660 4008959..4010152 - 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T260692 WP_002892050.1 NZ_CP107303:c4004903-4004685 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT260692 WP_002892066.1 NZ_CP107303:c4005304-4004930 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References