Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 61032..61675 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP107299 | ||
| Organism | Klebsiella pneumoniae strain CRKP_44 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | D8L2J9 |
| Locus tag | OH517_RS29055 | Protein ID | WP_001044770.1 |
| Coordinates | 61032..61448 (-) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | D5KTK7 |
| Locus tag | OH517_RS29060 | Protein ID | WP_001261282.1 |
| Coordinates | 61445..61675 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OH517_RS29035 (57135) | 57135..57407 | - | 273 | Protein_76 | transposase | - |
| OH517_RS29045 (58389) | 58389..59411 | - | 1023 | WP_000361404.1 | helicase UvrD | - |
| OH517_RS29050 (59396) | 59396..60958 | - | 1563 | WP_004206609.1 | AAA family ATPase | - |
| OH517_RS29055 (61032) | 61032..61448 | - | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| OH517_RS29060 (61445) | 61445..61675 | - | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| OH517_RS29065 (61632) | 61632..62093 | + | 462 | WP_014343465.1 | hypothetical protein | - |
| OH517_RS29070 (62254) | 62254..63198 | + | 945 | WP_011977810.1 | hypothetical protein | - |
| OH517_RS29075 (63235) | 63235..63627 | + | 393 | WP_011977811.1 | hypothetical protein | - |
| OH517_RS29080 (63685) | 63685..64206 | + | 522 | WP_013214008.1 | hypothetical protein | - |
| OH517_RS29085 (64252) | 64252..64455 | + | 204 | WP_011977813.1 | hypothetical protein | - |
| OH517_RS29090 (64485) | 64485..65489 | + | 1005 | WP_011977814.1 | hypothetical protein | - |
| OH517_RS29095 (65673) | 65673..66452 | + | 780 | WP_013214009.1 | site-specific integrase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaTEM-1B / rmtB / blaSHV-12 / blaKPC-2 / blaCTX-M-65 / tet(A) / blaLAP-2 / qnrS1 / dfrA14 / sul2 / fosA3 | - | 1..215446 | 215446 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T260675 WP_001044770.1 NZ_CP107299:c61448-61032 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GYM2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GZG3 |