Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 130198..130868 | Replicon | plasmid unnamed1 |
Accession | NZ_CP107298 | ||
Organism | Klebsiella pneumoniae strain CRKP_44 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | Q6U619 |
Locus tag | OH517_RS28130 | Protein ID | WP_004213072.1 |
Coordinates | 130425..130868 (+) | Length | 148 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | Q6U620 |
Locus tag | OH517_RS28125 | Protein ID | WP_004213073.1 |
Coordinates | 130198..130428 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OH517_RS28095 | 125383..126162 | - | 780 | WP_004213560.1 | site-specific integrase | - |
OH517_RS28100 | 126159..126980 | - | 822 | WP_004213562.1 | hypothetical protein | - |
OH517_RS28105 | 127525..127728 | - | 204 | Protein_128 | hypothetical protein | - |
OH517_RS28110 | 127952..128158 | + | 207 | WP_004213077.1 | hypothetical protein | - |
OH517_RS28115 | 128148..128441 | - | 294 | WP_004213076.1 | hypothetical protein | - |
OH517_RS28120 | 128457..129590 | - | 1134 | WP_004213075.1 | DUF3800 domain-containing protein | - |
OH517_RS28125 | 130198..130428 | + | 231 | WP_004213073.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OH517_RS28130 | 130425..130868 | + | 444 | WP_004213072.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OH517_RS28135 | 131017..131268 | + | 252 | WP_186987481.1 | hypothetical protein | - |
OH517_RS28140 | 131291..131595 | - | 305 | Protein_135 | transposase | - |
OH517_RS28145 | 132012..132647 | + | 636 | Protein_136 | mucoid phenotype regulator RmpA2 | - |
OH517_RS28150 | 133165..133568 | - | 404 | Protein_137 | GAF domain-containing protein | - |
OH517_RS28155 | 133659..134579 | - | 921 | WP_004213934.1 | DUF1471 domain-containing protein | - |
OH517_RS28160 | 134628..135119 | - | 492 | WP_011251327.1 | DM13 domain-containing protein | - |
OH517_RS28165 | 135182..135457 | - | 276 | WP_004213932.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN | 1..217869 | 217869 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16006.74 Da Isoelectric Point: 9.3642
>T260669 WP_004213072.1 NZ_CP107298:130425-130868 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|