Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 149158..149801 Replicon plasmid unnamed2
Accession NZ_CP107293
Organism Klebsiella pneumoniae strain CRKP_45

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag OH513_RS29595 Protein ID WP_001044770.1
Coordinates 149385..149801 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag OH513_RS29590 Protein ID WP_001261282.1
Coordinates 149158..149388 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH513_RS29555 (144381) 144381..145160 - 780 WP_013214009.1 site-specific integrase -
OH513_RS29560 (145344) 145344..146348 - 1005 WP_011977814.1 hypothetical protein -
OH513_RS29565 (146378) 146378..146581 - 204 WP_011977813.1 hypothetical protein -
OH513_RS29570 (146627) 146627..147148 - 522 WP_013214008.1 hypothetical protein -
OH513_RS29575 (147206) 147206..147598 - 393 WP_011977811.1 hypothetical protein -
OH513_RS29580 (147635) 147635..148579 - 945 WP_011977810.1 hypothetical protein -
OH513_RS29585 (148740) 148740..149201 - 462 WP_014343465.1 hypothetical protein -
OH513_RS29590 (149158) 149158..149388 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
OH513_RS29595 (149385) 149385..149801 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
OH513_RS29600 (149875) 149875..151437 + 1563 WP_004206609.1 AAA family ATPase -
OH513_RS29605 (151422) 151422..152444 + 1023 WP_000361404.1 helicase UvrD -
OH513_RS29610 (152700) 152700..153397 + 698 WP_223174630.1 IS1 family transposase -
OH513_RS29615 (153426) 153426..153698 + 273 Protein_194 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid rmtB / blaTEM-1B / fosA3 / sul2 / dfrA14 / qnrS1 / blaLAP-2 / tet(A) / blaCTX-M-65 / blaKPC-2 / blaSHV-12 - 1..205511 205511


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T260649 WP_001044770.1 NZ_CP107293:149385-149801 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT260649 WP_001261282.1 NZ_CP107293:149158-149388 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References