Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 168822..169732 Replicon plasmid unnamed1
Accession NZ_CP107292
Organism Klebsiella pneumoniae strain CRKP_45

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag OH513_RS28360 Protein ID WP_004026354.1
Coordinates 169262..169732 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag OH513_RS28355 Protein ID WP_004026357.1
Coordinates 168822..169265 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OH513_RS28325 163857..164258 + 402 WP_214588034.1 LuxR C-terminal-related transcriptional regulator -
OH513_RS28330 164331..165233 + 903 WP_004213613.1 DMT family inner membrane transporter PEG344 -
OH513_RS28335 165376..165597 - 222 WP_004213615.1 hypothetical protein -
OH513_RS28340 165659..166966 - 1308 Protein_177 FepA family TonB-dependent siderophore receptor -
OH513_RS28345 167032..168012 + 981 WP_000019473.1 IS5-like element ISKpn26 family transposase -
OH513_RS28350 168218..168721 + 504 Protein_179 DUF4113 domain-containing protein -
OH513_RS28355 168822..169265 + 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
OH513_RS28360 169262..169732 + 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
OH513_RS28365 169881..170578 + 698 WP_223175001.1 IS1-like element IS1A family transposase -
OH513_RS28370 171964..172614 - 651 WP_068893702.1 DUF1173 family protein -
OH513_RS28375 172647..172913 - 267 WP_223175074.1 DUF1173 family protein -
OH513_RS28380 173091..173585 + 495 WP_004212794.1 thermonuclease family protein -
OH513_RS28385 173922..174320 + 399 WP_004212796.1 H-NS family nucleoid-associated regulatory protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA2 / iutA / iucD / iucC / iucB / iucA / rmpA / iroN 1..217869 217869
- inside IScluster/Tn - - 167032..175771 8739


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T260643 WP_004026354.1 NZ_CP107292:169262-169732 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT260643 WP_004026357.1 NZ_CP107292:168822-169265 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References