Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 493036..493689 | Replicon | chromosome |
| Accession | NZ_CP107289 | ||
| Organism | Acinetobacter pittii strain BM4623 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | OFU58_RS02410 | Protein ID | WP_119685828.1 |
| Coordinates | 493300..493689 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A009HHW9 |
| Locus tag | OFU58_RS02405 | Protein ID | WP_002117064.1 |
| Coordinates | 493036..493293 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OFU58_RS02385 (OFU58_02385) | 488549..489556 | + | 1008 | WP_002116730.1 | DNA-directed RNA polymerase subunit alpha | - |
| OFU58_RS02390 (OFU58_02390) | 489575..489952 | + | 378 | WP_002049717.1 | 50S ribosomal protein L17 | - |
| OFU58_RS02395 (OFU58_02395) | 490134..491624 | + | 1491 | WP_075384069.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| OFU58_RS02400 (OFU58_02400) | 491675..492847 | - | 1173 | WP_068929632.1 | acyl-CoA dehydrogenase family protein | - |
| OFU58_RS02405 (OFU58_02405) | 493036..493293 | + | 258 | WP_002117064.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| OFU58_RS02410 (OFU58_02410) | 493300..493689 | + | 390 | WP_119685828.1 | hypothetical protein | Toxin |
| OFU58_RS02415 (OFU58_02415) | 494460..495548 | + | 1089 | WP_014207738.1 | hypothetical protein | - |
| OFU58_RS02420 (OFU58_02420) | 495633..496208 | + | 576 | WP_005078319.1 | rhombosortase | - |
| OFU58_RS02425 (OFU58_02425) | 496388..498583 | + | 2196 | WP_017400431.1 | TRAP transporter large permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15456.55 Da Isoelectric Point: 8.7390
>T260627 WP_119685828.1 NZ_CP107289:493300-493689 [Acinetobacter pittii]
MIKELNFELKYSRVSVIFQLFVGLGLAILLYQLLTPMWWLCAVVLLFIGFIFFLKQAQISQIEYLDQKLWSVAYFSEKEI
YRAEITKIIDYQLFVVLYFEGGPTKIAIVWFDQLPIQQWKRLKVLEKLY
MIKELNFELKYSRVSVIFQLFVGLGLAILLYQLLTPMWWLCAVVLLFIGFIFFLKQAQISQIEYLDQKLWSVAYFSEKEI
YRAEITKIIDYQLFVVLYFEGGPTKIAIVWFDQLPIQQWKRLKVLEKLY
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|