260624

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 27150..27742 Replicon plasmid p34
Accession NZ_CP107287
Organism Escherichia coli strain SW4848

Toxin (Protein)


Gene name hicA Uniprot ID V0AGQ2
Locus tag OF379_RS25040 Protein ID WP_000520549.1
Coordinates 27494..27742 (-) Length 83 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID V0AWG0
Locus tag OF379_RS25035 Protein ID WP_000681613.1
Coordinates 27150..27497 (-) Length 116 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OF379_RS25005 (OF379_25005) 23152..23478 - 327 WP_000008644.1 TrbC/VirB2 family protein -
OF379_RS25010 (OF379_25010) 23492..24112 - 621 WP_000157549.1 lytic transglycosylase domain-containing protein -
OF379_RS25015 (OF379_25015) 24469..24684 - 216 WP_000760375.1 EexN family lipoprotein -
OF379_RS25020 (OF379_25020) 24681..24974 - 294 WP_000134733.1 sigma factor-like helix-turn-helix DNA-binding protein -
OF379_RS25025 (OF379_25025) 25051..26280 - 1230 WP_016231858.1 DNA relaxase/nickase TaxC -
OF379_RS25030 (OF379_25030) 26284..26787 - 504 WP_000781814.1 relaxosome-coupling protein TaxA -
OF379_RS25035 (OF379_25035) 27150..27497 - 348 WP_000681613.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OF379_RS25040 (OF379_25040) 27494..27742 - 249 WP_000520549.1 type II toxin-antitoxin system HicA family toxin Toxin
OF379_RS25045 (OF379_25045) 28052..28345 - 294 WP_001401669.1 hypothetical protein -
OF379_RS25050 (OF379_25050) 28360..28734 - 375 WP_000844303.1 tail-associated lysozyme -
OF379_RS25055 (OF379_25055) 28786..29085 - 300 WP_263955274.1 hypothetical protein -
OF379_RS25060 (OF379_25060) 29539..29766 - 228 WP_000801440.1 hypothetical protein -
OF379_RS25065 (OF379_25065) 29756..30004 - 249 WP_001230706.1 hypothetical protein -
OF379_RS25070 (OF379_25070) 30001..30543 - 543 WP_001083906.1 hypothetical protein -
OF379_RS25075 (OF379_25075) 30648..31163 - 516 WP_001025395.1 J domain-containing protein -
OF379_RS25080 (OF379_25080) 31803..32153 - 351 WP_000127482.1 addiction module antitoxin -
OF379_RS25085 (OF379_25085) 32150..32485 - 336 WP_001147119.1 type II toxin-antitoxin system RelE/ParE family toxin -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..33549 33549


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(20-81)

Antitoxin

Uncharacterised protein family HicB

(54-104)


Sequences

Toxin        


Download         Length: 83 a.a.        Molecular weight: 9422.08 Da        Isoelectric Point: 10.4800

>T260624 WP_000520549.1 NZ_CP107287:c27742-27494 [Escherichia coli]
MGKTDKLLAKFLNSKKTFEWDELVVLFSSLGYVKKEMQGSRVRFFNAEINHTILMHRPHPESYIKGGTLKAIKQNLKEAG
LL

Download         Length: 249 bp

Antitoxin


Download         Length: 116 a.a.        Molecular weight: 13113.84 Da        Isoelectric Point: 4.6723

>AT260624 WP_000681613.1 NZ_CP107287:c27497-27150 [Escherichia coli]
MKHLKYKGYLGTVEPDFENNVLYGKLAFIRDLVTYEASTLAELEQEFKTSVDLYLQSCVEDGKEPDTPFKGVFNVRLDPE
LHRRVAEMAMEEDLSLNAFVNKALEKEVSNHRAGA

Download         Length: 348 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CIX3

Antitoxin

Source ID Structure
AlphaFold DB A0A829CLC1

References