Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelE-RHH
Location 53674..54221 Replicon plasmid p152
Accession NZ_CP107285
Organism Escherichia coli strain SW4848

Toxin (Protein)


Gene name parE Uniprot ID G7QEJ9
Locus tag OF379_RS24290 Protein ID WP_001384452.1
Coordinates 53674..53952 (-) Length 93 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID E1QMW3
Locus tag OF379_RS24295 Protein ID WP_000079941.1
Coordinates 53952..54221 (-) Length 90 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OF379_RS24260 (49104) 49104..49364 + 261 WP_000343091.1 hypothetical protein -
OF379_RS24265 (49361) 49361..49951 + 591 WP_001518980.1 hypothetical protein -
OF379_RS24270 (50013) 50013..50228 - 216 Protein_46 DUF6404 family protein -
OF379_RS24275 (50357) 50357..50692 + 336 WP_001080729.1 colicin 1A immunity protein -
OF379_RS24280 (50714) 50714..52594 - 1881 WP_001283335.1 colicin Ia central receptor-binding domain-containing protein -
OF379_RS24285 (52780) 52780..53628 - 849 WP_001057989.1 3'-5' exonuclease -
OF379_RS24290 (53674) 53674..53952 - 279 WP_001384452.1 type II toxin-antitoxin system toxin YacB Toxin
OF379_RS24295 (53952) 53952..54221 - 270 WP_000079941.1 type II toxin-antitoxin system antitoxin YacA Antitoxin
OF379_RS24300 (54865) 54865..56616 - 1752 Protein_52 Tn3-like element TnAs1 family transposase -
OF379_RS24305 (56620) 56620..57012 + 393 WP_001351729.1 isochorismatase family cysteine hydrolase -
OF379_RS24310 (57150) 57150..58034 + 885 WP_000058717.1 EamA family transporter -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid tet(A) / dfrA5 / sul2 / aph(3'')-Ib / aph(6)-Id / sitABCD iroB / iroC / iroD / iroE / iroN / iutA / iucD / iucC / iucB / iucA 1..151562 151562


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(3-91)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 93 a.a.        Molecular weight: 10762.38 Da        Isoelectric Point: 8.4615

>T260623 WP_001384452.1 NZ_CP107285:c53952-53674 [Escherichia coli]
MEIFWTMLASQDRKRIREYIAEQNLMAAIELDERIGYSASSLAGQPYKGRNGRVEGTRELVIHPHFVLVYEVDSQWGKVY
ILRVLHTAQKWP

Download         Length: 279 bp

Antitoxin


Download         Length: 90 a.a.        Molecular weight: 10252.58 Da        Isoelectric Point: 7.2057

>AT260623 WP_000079941.1 NZ_CP107285:c54221-53952 [Escherichia coli]
MAQVNMSLRIDAELKDAFMAAAKSMDRNGSQLIRDFMRQTVERQHNTWFRDQVEAGRQQLERGDVLPHDMVESSAAAWRD
EMSRKVAGK

Download         Length: 270 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CL36

Antitoxin

Source ID Structure
AlphaFold DB A0A629TXC5

References