Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4413000..4413522 | Replicon | chromosome |
| Accession | NZ_CP107284 | ||
| Organism | Escherichia coli strain SW4848 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A829L6G8 |
| Locus tag | OF379_RS21285 | Protein ID | WP_001105433.1 |
| Coordinates | 4413000..4413290 (-) | Length | 97 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | V0SC69 |
| Locus tag | OF379_RS21290 | Protein ID | WP_000212715.1 |
| Coordinates | 4413280..4413522 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF379_RS21270 (4408163) | 4408163..4409818 | + | 1656 | WP_001315166.1 | alpha,alpha-phosphotrehalase | - |
| OF379_RS21275 (4410212) | 4410212..4412350 | + | 2139 | WP_000187798.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| OF379_RS21280 (4412535) | 4412535..4412999 | + | 465 | WP_001009182.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| OF379_RS21285 (4413000) | 4413000..4413290 | - | 291 | WP_001105433.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OF379_RS21290 (4413280) | 4413280..4413522 | - | 243 | WP_000212715.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| OF379_RS21295 (4413714) | 4413714..4414100 | - | 387 | WP_001232253.1 | cytochrome b562 | - |
| OF379_RS21300 (4414283) | 4414283..4415635 | - | 1353 | WP_001162173.1 | metalloprotease PmbA | - |
| OF379_RS21305 (4415729) | 4415729..4416280 | + | 552 | WP_000166270.1 | ribosome biogenesis factor YjgA | - |
| OF379_RS21310 (4416363) | 4416363..4417736 | - | 1374 | WP_001219814.1 | UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- meso-diaminopimelate ligase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11367.23 Da Isoelectric Point: 10.0238
>T260620 WP_001105433.1 NZ_CP107284:c4413290-4413000 [Escherichia coli]
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
MNYELAFDPRALKEWQKLGVTVREQFKKKLEDVLKRPRNPSAKLRDLPDCYKIKLRTQGYRLVYQVNDKELLVLVIAIGK
RENSAVYEDATKRLDE
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829L6G8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9H4B3 |