Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3691884..3692502 | Replicon | chromosome |
Accession | NZ_CP107284 | ||
Organism | Escherichia coli strain SW4848 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | OF379_RS17880 | Protein ID | WP_001291435.1 |
Coordinates | 3692284..3692502 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | OF379_RS17875 | Protein ID | WP_000344800.1 |
Coordinates | 3691884..3692258 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OF379_RS17865 (3686973) | 3686973..3688166 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
OF379_RS17870 (3688189) | 3688189..3691338 | + | 3150 | WP_001132480.1 | efflux RND transporter permease AcrB | - |
OF379_RS17875 (3691884) | 3691884..3692258 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
OF379_RS17880 (3692284) | 3692284..3692502 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
OF379_RS17885 (3692674) | 3692674..3693225 | + | 552 | WP_000102564.1 | maltose O-acetyltransferase | - |
OF379_RS17890 (3693341) | 3693341..3693811 | + | 471 | WP_000136192.1 | YlaC family protein | - |
OF379_RS17895 (3693975) | 3693975..3695525 | + | 1551 | WP_001366446.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
OF379_RS17900 (3695567) | 3695567..3695920 | - | 354 | WP_000878140.1 | DUF1428 domain-containing protein | - |
OF379_RS17910 (3696299) | 3696299..3696610 | + | 312 | WP_000409911.1 | MGMT family protein | - |
OF379_RS17915 (3696641) | 3696641..3697213 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T260616 WP_001291435.1 NZ_CP107284:3692284-3692502 [Escherichia coli]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT260616 WP_000344800.1 NZ_CP107284:3691884-3692258 [Escherichia coli]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |