Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 2972782..2973626 Replicon chromosome
Accession NZ_CP107284
Organism Escherichia coli strain SW4848

Toxin (Protein)


Gene name yeeV Uniprot ID B1LJY4
Locus tag OF379_RS14510 Protein ID WP_000854686.1
Coordinates 2972782..2973165 (-) Length 128 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A8E0J1S3
Locus tag OF379_RS14515 Protein ID WP_001285602.1
Coordinates 2973246..2973626 (-) Length 127 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OF379_RS14470 (2967784) 2967784..2968275 - 492 WP_032159295.1 DUF1097 domain-containing protein -
OF379_RS14475 (2968377) 2968377..2968931 - 555 WP_001001926.1 molecular chaperone YcdY -
OF379_RS14480 (2968955) 2968955..2969692 - 738 WP_000283664.1 zinc-binding phosphatase -
OF379_RS14485 (2969747) 2969747..2970685 - 939 WP_000351297.1 glyoxylate/hydroxypyruvate reductase GhrA -
OF379_RS14495 (2971156) 2971156..2971998 - 843 WP_001431817.1 DUF4942 domain-containing protein -
OF379_RS14500 (2972083) 2972083..2972280 - 198 WP_000839253.1 DUF957 domain-containing protein -
OF379_RS14505 (2972297) 2972297..2972785 - 489 WP_001054233.1 DUF5983 family protein -
OF379_RS14510 (2972782) 2972782..2973165 - 384 WP_000854686.1 TA system toxin CbtA family protein Toxin
OF379_RS14515 (2973246) 2973246..2973626 - 381 WP_001285602.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
OF379_RS14520 (2973637) 2973637..2974320 - 684 WP_000086768.1 hypothetical protein -
OF379_RS14525 (2974339) 2974339..2974560 - 222 WP_000692298.1 DUF987 domain-containing protein -
OF379_RS14530 (2974623) 2974623..2975099 - 477 WP_001186773.1 RadC family protein -
OF379_RS14535 (2975115) 2975115..2975600 - 486 WP_000214307.1 antirestriction protein -
OF379_RS14540 (2975692) 2975692..2976510 - 819 WP_001234732.1 DUF932 domain-containing protein -
OF379_RS14545 (2976610) 2976610..2976843 - 234 WP_001119717.1 DUF905 family protein -
OF379_RS14550 (2976922) 2976922..2977377 - 456 WP_001504120.1 IrmA family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - csgB / csgD / csgE / csgF / csgG / aafC / aggD / iroC / iroD / iroE / iroN 2964165..3028672 64507


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-113)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 128 a.a.        Molecular weight: 14272.28 Da        Isoelectric Point: 6.8614

>T260614 WP_000854686.1 NZ_CP107284:c2973165-2972782 [Escherichia coli]
MKTLPDTHVRAASRCPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYVLVRTDQPGF
SAGAPSSQLINSIDILRARRATGLMTRDNYRMVNNITLGKHPEEAKQ

Download         Length: 384 bp

Antitoxin


Download         Length: 127 a.a.        Molecular weight: 13938.69 Da        Isoelectric Point: 5.0823

>AT260614 WP_001285602.1 NZ_CP107284:c2973626-2973246 [Escherichia coli]
VSDTLPGTTLPDDNKDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSNADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCDADTLGSCGYVYLAVYPATETESNPPE

Download         Length: 381 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References