Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1054195..1054778 | Replicon | chromosome |
Accession | NZ_CP107284 | ||
Organism | Escherichia coli strain SW4848 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | A0A377LAP4 |
Locus tag | OF379_RS04970 | Protein ID | WP_000254736.1 |
Coordinates | 1054443..1054778 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S1P3W5 |
Locus tag | OF379_RS04965 | Protein ID | WP_000581937.1 |
Coordinates | 1054195..1054443 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OF379_RS04955 (1050534) | 1050534..1051835 | + | 1302 | WP_000046786.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
OF379_RS04960 (1051883) | 1051883..1054117 | + | 2235 | WP_000226799.1 | GTP diphosphokinase | - |
OF379_RS04965 (1054195) | 1054195..1054443 | + | 249 | WP_000581937.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
OF379_RS04970 (1054443) | 1054443..1054778 | + | 336 | WP_000254736.1 | endoribonuclease MazF | Toxin |
OF379_RS04975 (1054849) | 1054849..1055640 | + | 792 | WP_001071667.1 | nucleoside triphosphate pyrophosphohydrolase | - |
OF379_RS04980 (1055868) | 1055868..1057505 | + | 1638 | WP_000210878.1 | CTP synthase (glutamine hydrolyzing) | - |
OF379_RS04985 (1057593) | 1057593..1058891 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12125.11 Da Isoelectric Point: 8.7181
>T260608 WP_000254736.1 NZ_CP107284:1054443-1054778 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGKVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQAGHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGKVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A377LAP4 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 1UB4 | |
PDB | 5CQX | |
PDB | 5CQY | |
PDB | 1MVF | |
PDB | 2MRN | |
PDB | 2MRU | |
AlphaFold DB | A0A7U9LMB4 |