Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 908809..909463 | Replicon | chromosome |
| Accession | NZ_CP107284 | ||
| Organism | Escherichia coli strain SW4848 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | S1EEB2 |
| Locus tag | OF379_RS04320 | Protein ID | WP_000244777.1 |
| Coordinates | 909056..909463 (+) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | A0A7B2N3K9 |
| Locus tag | OF379_RS04315 | Protein ID | WP_001604807.1 |
| Coordinates | 908809..909075 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF379_RS04290 (904092) | 904092..904835 | + | 744 | WP_001366570.1 | SDR family oxidoreductase | - |
| OF379_RS04295 (904897) | 904897..906330 | - | 1434 | WP_001604813.1 | 6-phospho-beta-glucosidase BglA | - |
| OF379_RS04300 (906375) | 906375..906686 | + | 312 | WP_001604811.1 | N(4)-acetylcytidine aminohydrolase | - |
| OF379_RS04305 (906850) | 906850..907509 | + | 660 | WP_000250269.1 | hemolysin III family protein | - |
| OF379_RS04310 (907586) | 907586..908566 | - | 981 | WP_001604809.1 | tRNA-modifying protein YgfZ | - |
| OF379_RS04315 (908809) | 908809..909075 | + | 267 | WP_001604807.1 | FAD assembly factor SdhE | Antitoxin |
| OF379_RS04320 (909056) | 909056..909463 | + | 408 | WP_000244777.1 | protein YgfX | Toxin |
| OF379_RS04325 (909503) | 909503..910024 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
| OF379_RS04330 (910136) | 910136..911032 | + | 897 | WP_000806650.1 | site-specific tyrosine recombinase XerD | - |
| OF379_RS04335 (911057) | 911057..911767 | + | 711 | WP_000715210.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| OF379_RS04340 (911773) | 911773..913506 | + | 1734 | WP_000813188.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16031.96 Da Isoelectric Point: 11.5202
>T260607 WP_000244777.1 NZ_CP107284:909056-909463 [Escherichia coli]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLMPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDGGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9LFV7 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7B2N3K9 |