Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 159903..160515 | Replicon | chromosome |
Accession | NZ_CP107284 | ||
Organism | Escherichia coli strain SW4848 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | A0A167AMN3 |
Locus tag | OF379_RS00690 | Protein ID | WP_000833474.1 |
Coordinates | 159903..160088 (+) | Length | 62 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | A0A1V3VHB3 |
Locus tag | OF379_RS00695 | Protein ID | WP_000499746.1 |
Coordinates | 160105..160515 (+) | Length | 137 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OF379_RS00675 (155420) | 155420..156571 | + | 1152 | WP_000741506.1 | L-threonine dehydrogenase | - |
OF379_RS00680 (156772) | 156772..158310 | + | 1539 | WP_001469350.1 | aldehyde dehydrogenase AldB | - |
OF379_RS00685 (158351) | 158351..159430 | - | 1080 | WP_000061479.1 | type I restriction enzyme HsdR N-terminal domain-containing protein | - |
OF379_RS00690 (159903) | 159903..160088 | + | 186 | WP_000833474.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
OF379_RS00695 (160105) | 160105..160515 | + | 411 | WP_000499746.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OF379_RS00700 (160587) | 160587..162551 | - | 1965 | WP_001026871.1 | glycoside hydrolase family 127 protein | - |
OF379_RS00705 (162562) | 162562..163962 | - | 1401 | WP_000204815.1 | MFS transporter | - |
OF379_RS00710 (164188) | 164188..165003 | + | 816 | WP_000891838.1 | AraC family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 62 a.a. Molecular weight: 6819.94 Da Isoelectric Point: 12.0345
>T260605 WP_000833474.1 NZ_CP107284:159903-160088 [Escherichia coli]
VKSADVIAILKQHGWEHIRTRGSRHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
VKSADVIAILKQHGWEHIRTRGSRHQFRHPVHPGLVTVPHPKKDIKPGTLAQIGRQAGLTF
Download Length: 186 bp
Antitoxin
Download Length: 137 a.a. Molecular weight: 15290.22 Da Isoelectric Point: 4.5486
>AT260605 WP_000499746.1 NZ_CP107284:160105-160515 [Escherichia coli]
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDYAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
MFYPAYIHSDPDGSASGFFPDVPGCYFAGDTLDYAFQDARSALVAHFETLCEMNEELPLPGSVETHLVQRAQDFIGGQWL
LVDINMNQFEGRAERINITMPKRLLNKIDTYVRNNPDYANRSAFLAEAARRVLPGV
Download Length: 411 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A167AMN3 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1V3VHB3 |