Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
| Location | 1927250..1927883 | Replicon | chromosome |
| Accession | NZ_CP107276 | ||
| Organism | Weizmannia coagulans strain 150 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G2TIM0 |
| Locus tag | OF848_RS09735 | Protein ID | WP_013860680.1 |
| Coordinates | 1927250..1927600 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | G2TIL9 |
| Locus tag | OF848_RS09740 | Protein ID | WP_014096808.1 |
| Coordinates | 1927605..1927883 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF848_RS09700 (OF848_09700) | 1922435..1923214 | - | 780 | WP_029142785.1 | RNA polymerase sigma factor SigB | - |
| OF848_RS09705 (OF848_09705) | 1923192..1923662 | - | 471 | WP_017553287.1 | anti-sigma B factor RsbW | - |
| OF848_RS09710 (OF848_09710) | 1923666..1923995 | - | 330 | WP_013860674.1 | anti-sigma factor antagonist | - |
| OF848_RS09715 (OF848_09715) | 1924064..1925074 | - | 1011 | WP_029142786.1 | PP2C family protein-serine/threonine phosphatase | - |
| OF848_RS09720 (OF848_09720) | 1925089..1925490 | - | 402 | WP_263931224.1 | anti-sigma regulatory factor | - |
| OF848_RS09725 (OF848_09725) | 1925495..1925851 | - | 357 | WP_017553290.1 | STAS domain-containing protein | - |
| OF848_RS09730 (OF848_09730) | 1925855..1926682 | - | 828 | WP_029142788.1 | RsbT co-antagonist protein RsbRA | - |
| OF848_RS09735 (OF848_09735) | 1927250..1927600 | - | 351 | WP_013860680.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OF848_RS09740 (OF848_09740) | 1927605..1927883 | - | 279 | WP_014096808.1 | hypothetical protein | Antitoxin |
| OF848_RS09745 (OF848_09745) | 1928036..1929187 | - | 1152 | WP_029142789.1 | alanine racemase | - |
| OF848_RS09750 (OF848_09750) | 1929389..1930405 | - | 1017 | WP_013860683.1 | outer membrane lipoprotein carrier protein LolA | - |
| OF848_RS09755 (OF848_09755) | 1930546..1930896 | - | 351 | WP_029142790.1 | holo-ACP synthase | - |
| OF848_RS09760 (OF848_09760) | 1931178..1931777 | + | 600 | WP_029142791.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12968.01 Da Isoelectric Point: 4.8998
>T260603 WP_013860680.1 NZ_CP107276:c1927600-1927250 [Weizmannia coagulans]
MIVKRGDVYFADLSPVVGSEQGGVRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGLERDSVILLEQI
RTIDKQRLTDKITHLDEEVMEKIDDALQISLGLVEF
MIVKRGDVYFADLSPVVGSEQGGVRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGLERDSVILLEQI
RTIDKQRLTDKITHLDEEVMEKIDDALQISLGLVEF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B4BYJ0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B4BX66 |