Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 4627595..4628637 | Replicon | chromosome |
Accession | NZ_CP107275 | ||
Organism | Pseudomonas aeruginosa strain PALA22 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | PALA22_RS21410 | Protein ID | WP_003153636.1 |
Coordinates | 4627595..4628170 (-) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | PALA22_RS21415 | Protein ID | WP_003050245.1 |
Coordinates | 4628167..4628637 (-) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PALA22_RS21385 (PALA22_04244) | 4624033..4624758 | - | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
PALA22_RS21390 (PALA22_04245) | 4624797..4625699 | - | 903 | WP_003090158.1 | CBASS oligonucleotide cyclase | - |
PALA22_RS21395 (PALA22_04246) | 4625699..4626199 | - | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
PALA22_RS21400 (PALA22_04247) | 4626196..4626666 | - | 471 | WP_003090160.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
PALA22_RS21405 (PALA22_04248) | 4626663..4627577 | - | 915 | WP_003050256.1 | AAA family ATPase | - |
PALA22_RS21410 (PALA22_04249) | 4627595..4628170 | - | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
PALA22_RS21415 (PALA22_04250) | 4628167..4628637 | - | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
PALA22_RS21420 (PALA22_04251) | 4628841..4629224 | + | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
PALA22_RS21425 (PALA22_04252) | 4629221..4629454 | + | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
PALA22_RS21430 (PALA22_04253) | 4629471..4629830 | + | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
PALA22_RS21435 (PALA22_04254) | 4629842..4630240 | + | 399 | WP_009516221.1 | TIGR03750 family conjugal transfer protein | - |
PALA22_RS21440 (PALA22_04255) | 4630237..4630929 | + | 693 | WP_009516220.1 | TIGR03746 family integrating conjugative element protein | - |
PALA22_RS21445 (PALA22_04256) | 4630926..4631834 | + | 909 | WP_009516219.1 | TIGR03749 family integrating conjugative element protein | - |
PALA22_RS21450 (PALA22_04257) | 4631824..4633254 | + | 1431 | WP_033961856.1 | TIGR03752 family integrating conjugative element protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 4581732..4701582 | 119850 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T260599 WP_003153636.1 NZ_CP107275:c4628170-4627595 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT260599 WP_003050245.1 NZ_CP107275:c4628637-4628167 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|