Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 962729..963384 | Replicon | chromosome |
Accession | NZ_CP107274 | ||
Organism | Neisseria gonorrhoeae strain 1145734 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | OHM01_RS04985 | Protein ID | WP_003691083.1 |
Coordinates | 962729..963148 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | OHM01_RS04990 | Protein ID | WP_003688410.1 |
Coordinates | 963148..963384 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OHM01_RS04965 (OHM01_04965) | 957963..959504 | - | 1542 | WP_003701286.1 | MDR family MFS transporter | - |
OHM01_RS04970 (OHM01_04970) | 959652..960431 | + | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
OHM01_RS04975 (OHM01_04975) | 960428..961129 | + | 702 | WP_003688414.1 | lactate utilization protein C | - |
OHM01_RS04980 (OHM01_04980) | 961126..962580 | + | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
OHM01_RS04985 (OHM01_04985) | 962729..963148 | - | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
OHM01_RS04990 (OHM01_04990) | 963148..963384 | - | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
OHM01_RS04995 (OHM01_04995) | 963832..964410 | - | 579 | WP_003688041.1 | IS3 family transposase | - |
OHM01_RS05000 (OHM01_05000) | 964415..964705 | - | 291 | WP_041420764.1 | helix-turn-helix domain-containing protein | - |
OHM01_RS05005 (OHM01_05005) | 965055..965441 | + | 387 | Protein_977 | transposase | - |
OHM01_RS05010 (OHM01_05010) | 965824..966714 | - | 891 | WP_002244992.1 | succinate--CoA ligase subunit alpha | - |
OHM01_RS05015 (OHM01_05015) | 966725..967891 | - | 1167 | WP_003688408.1 | ADP-forming succinate--CoA ligase subunit beta | - |
OHM01_RS05020 (OHM01_05020) | 967963..968250 | - | 288 | WP_025455945.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T260593 WP_003691083.1 NZ_CP107274:c963148-962729 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|