Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 535511..536196 | Replicon | chromosome |
| Accession | NZ_CP107274 | ||
| Organism | Neisseria gonorrhoeae strain 1145734 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | OHM01_RS02805 | Protein ID | WP_003689143.1 |
| Coordinates | 536014..536196 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | OHM01_RS02800 | Protein ID | WP_003691454.1 |
| Coordinates | 535511..535912 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OHM01_RS02745 (OHM01_02745) | 530564..530779 | - | 216 | WP_003691538.1 | hypothetical protein | - |
| OHM01_RS02750 (OHM01_02750) | 530831..531322 | - | 492 | WP_003691537.1 | siphovirus Gp157 family protein | - |
| OHM01_RS02755 (OHM01_02755) | 531319..531501 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| OHM01_RS02760 (OHM01_02760) | 531641..532327 | - | 687 | WP_042758540.1 | hypothetical protein | - |
| OHM01_RS02765 (OHM01_02765) | 532396..532557 | - | 162 | WP_003702497.1 | hypothetical protein | - |
| OHM01_RS02770 (OHM01_02770) | 532554..532832 | - | 279 | WP_003691529.1 | hypothetical protein | - |
| OHM01_RS02775 (OHM01_02775) | 532985..533317 | - | 333 | WP_003687946.1 | hypothetical protein | - |
| OHM01_RS02780 (OHM01_02780) | 533459..533734 | - | 276 | WP_263936426.1 | hypothetical protein | - |
| OHM01_RS02785 (OHM01_02785) | 533731..534207 | - | 477 | WP_071201010.1 | hypothetical protein | - |
| OHM01_RS02790 (OHM01_02790) | 534240..534440 | - | 201 | WP_263936427.1 | hypothetical protein | - |
| OHM01_RS02795 (OHM01_02795) | 534651..535412 | + | 762 | WP_012503753.1 | hypothetical protein | - |
| OHM01_RS02800 (OHM01_02800) | 535511..535912 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| OHM01_RS02805 (OHM01_02805) | 536014..536196 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| OHM01_RS02810 (OHM01_02810) | 536366..537184 | - | 819 | WP_263936428.1 | DUF3037 domain-containing protein | - |
| OHM01_RS02815 (OHM01_02815) | 537181..537879 | - | 699 | WP_003689139.1 | hypothetical protein | - |
| OHM01_RS02820 (OHM01_02820) | 538116..538826 | - | 711 | WP_263936429.1 | helix-turn-helix transcriptional regulator | - |
| OHM01_RS02825 (OHM01_02825) | 538942..539130 | + | 189 | WP_003689136.1 | helix-turn-helix domain-containing protein | - |
| OHM01_RS02830 (OHM01_02830) | 539210..539365 | + | 156 | WP_003691446.1 | hypothetical protein | - |
| OHM01_RS02835 (OHM01_02835) | 539342..539530 | - | 189 | WP_003691445.1 | hypothetical protein | - |
| OHM01_RS02840 (OHM01_02840) | 539703..539930 | + | 228 | WP_003691442.1 | helix-turn-helix domain-containing protein | - |
| OHM01_RS02845 (OHM01_02845) | 539927..540937 | + | 1011 | WP_263936359.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 527210..575264 | 48054 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T260592 WP_003689143.1 NZ_CP107274:c536196-536014 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT260592 WP_003691454.1 NZ_CP107274:c535912-535511 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|