Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 768864..769519 | Replicon | chromosome |
| Accession | NZ_CP107270 | ||
| Organism | Neisseria gonorrhoeae strain 1081168 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q5F882 |
| Locus tag | OHL99_RS04095 | Protein ID | WP_003691083.1 |
| Coordinates | 769100..769519 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q5F881 |
| Locus tag | OHL99_RS04090 | Protein ID | WP_003688410.1 |
| Coordinates | 768864..769100 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OHL99_RS04060 (OHL99_04060) | 763998..764285 | + | 288 | WP_003688407.1 | hypothetical protein | - |
| OHL99_RS04065 (OHL99_04065) | 764357..765523 | + | 1167 | WP_003688408.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| OHL99_RS04070 (OHL99_04070) | 765534..766424 | + | 891 | WP_002244992.1 | succinate--CoA ligase subunit alpha | - |
| OHL99_RS04075 (OHL99_04075) | 766807..767193 | - | 387 | Protein_787 | transposase | - |
| OHL99_RS04080 (OHL99_04080) | 767543..767833 | + | 291 | WP_041420764.1 | helix-turn-helix domain-containing protein | - |
| OHL99_RS04085 (OHL99_04085) | 767838..768416 | + | 579 | WP_003688041.1 | IS3 family transposase | - |
| OHL99_RS04090 (OHL99_04090) | 768864..769100 | + | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
| OHL99_RS04095 (OHL99_04095) | 769100..769519 | + | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
| OHL99_RS04100 (OHL99_04100) | 769668..771122 | - | 1455 | WP_003701282.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
| OHL99_RS04105 (OHL99_04105) | 771119..771820 | - | 702 | WP_003688414.1 | lactate utilization protein C | - |
| OHL99_RS04110 (OHL99_04110) | 771817..772596 | - | 780 | WP_041421436.1 | (Fe-S)-binding protein | - |
| OHL99_RS04115 (OHL99_04115) | 772744..774285 | + | 1542 | WP_003697015.1 | MDR family MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T260588 WP_003691083.1 NZ_CP107270:769100-769519 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|