Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-yefM/Txe-RelB
Location 1869343..1869872 Replicon chromosome
Accession NZ_CP107268
Organism Coxiella burnetii strain KZQ2

Toxin (Protein)


Gene name relE Uniprot ID Q83AB3
Locus tag OHM79_RS10175 Protein ID WP_005769718.1
Coordinates 1869597..1869872 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID Q83AB4
Locus tag OHM79_RS10170 Protein ID WP_005769716.1
Coordinates 1869343..1869597 (+) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OHM79_RS10125 1864411..1864785 + 375 WP_005769706.1 hypothetical protein -
OHM79_RS10130 1864830..1865528 + 699 WP_010958581.1 outer membrane beta-barrel protein -
OHM79_RS10135 1865592..1866533 + 942 WP_005769709.1 S49 family peptidase -
OHM79_RS10140 1866546..1867421 + 876 WP_005769711.1 symmetrical bis(5'-nucleosyl)-tetraphosphatase -
OHM79_RS10145 1867397..1867501 + 105 WP_230578142.1 type II toxin-antitoxin system YoeB family toxin -
OHM79_RS10150 1867570..1867704 + 135 WP_010958583.1 hypothetical protein -
OHM79_RS10155 1867865..1868884 + 1020 WP_263898541.1 IS110-like element IS1111A family transposase -
OHM79_RS10160 1868881..1869153 - 273 WP_005768315.1 hypothetical protein -
OHM79_RS10165 1869154..1869282 + 129 WP_230578144.1 hypothetical protein -
OHM79_RS10170 1869343..1869597 + 255 WP_005769716.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
OHM79_RS10175 1869597..1869872 + 276 WP_005769718.1 Txe/YoeB family addiction module toxin Toxin
OHM79_RS10180 1869845..1870330 - 486 WP_005769725.1 dihydrofolate reductase -
OHM79_RS10185 1870327..1871130 - 804 WP_238024516.1 epoxyqueuosine reductase QueH -
OHM79_RS10190 1871326..1871613 + 288 WP_005769730.1 acylphosphatase -
OHM79_RS10195 1871589..1872143 - 555 WP_005769732.1 D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase -
OHM79_RS10200 1872156..1873100 - 945 WP_238024517.1 methionyl-tRNA formyltransferase -
OHM79_RS10205 1873288..1874214 + 927 WP_012570936.1 DNA-processing protein DprA -
OHM79_RS10210 1874211..1874690 + 480 WP_011997413.1 DUF494 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1867865..1868884 1019


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 11150.86 Da        Isoelectric Point: 9.6762

>T260587 WP_005769718.1 NZ_CP107268:1869597-1869872 [Coxiella burnetii]
MQISFTPEAWEDYLYWQKFDKKMLRRINELIKDAMHEPFSGKGKPEPLKFELQGYWSRRLDQEHRLVYKVLDDSLMIIAA
RFHYNRLNSKN

Download         Length: 276 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9624.25 Da        Isoelectric Point: 10.4802

>AT260587 WP_005769716.1 NZ_CP107268:1869343-1869597 [Coxiella burnetii]
MNVVTFSELRAQLKKILDLSADQHEPVVVKRPNKETMVILSLRDFEALKETAYLLSNEANAARLRQSIRSLKQGKAQKKK
LMED

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q83AB3

Antitoxin

Source ID Structure
AlphaFold DB Q83AB4

References