Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 724722..725377 | Replicon | chromosome |
Accession | NZ_CP107266 | ||
Organism | Neisseria gonorrhoeae strain 9112 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | NDN54_RS03875 | Protein ID | WP_003691083.1 |
Coordinates | 724958..725377 (+) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | NDN54_RS03870 | Protein ID | WP_003688410.1 |
Coordinates | 724722..724958 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDN54_RS03840 (NDN54_03840) | 719856..720143 | + | 288 | WP_003688407.1 | hypothetical protein | - |
NDN54_RS03845 (NDN54_03845) | 720215..721381 | + | 1167 | WP_003701280.1 | ADP-forming succinate--CoA ligase subunit beta | - |
NDN54_RS03850 (NDN54_03850) | 721392..722282 | + | 891 | WP_002244992.1 | succinate--CoA ligase subunit alpha | - |
NDN54_RS03855 (NDN54_03855) | 722665..723051 | - | 387 | Protein_748 | IS110 family transposase | - |
NDN54_RS03860 (NDN54_03860) | 723401..723691 | + | 291 | WP_041420764.1 | helix-turn-helix domain-containing protein | - |
NDN54_RS03865 (NDN54_03865) | 723696..724274 | + | 579 | WP_003688041.1 | IS3 family transposase | - |
NDN54_RS03870 (NDN54_03870) | 724722..724958 | + | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
NDN54_RS03875 (NDN54_03875) | 724958..725377 | + | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
NDN54_RS03880 (NDN54_03880) | 725526..726980 | - | 1455 | WP_003701282.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
NDN54_RS03885 (NDN54_03885) | 726977..727678 | - | 702 | WP_003688414.1 | lactate utilization protein C | - |
NDN54_RS03890 (NDN54_03890) | 727675..728454 | - | 780 | WP_041421436.1 | (Fe-S)-binding protein | - |
NDN54_RS03895 (NDN54_03895) | 728602..730143 | + | 1542 | WP_003697015.1 | MDR family MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T260585 WP_003691083.1 NZ_CP107266:724958-725377 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|