Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1630735..1631420 | Replicon | chromosome |
| Accession | NZ_CP107264 | ||
| Organism | Neisseria gonorrhoeae strain 10231 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | Q5F6D1 |
| Locus tag | NDN57_RS08435 | Protein ID | WP_003689143.1 |
| Coordinates | 1631238..1631420 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | Q5F6D2 |
| Locus tag | NDN57_RS08430 | Protein ID | WP_003691454.1 |
| Coordinates | 1630735..1631136 (-) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NDN57_RS08385 (NDN57_008385) | 1626153..1626335 | - | 183 | WP_003691535.1 | hypothetical protein | - |
| NDN57_RS08390 (NDN57_008390) | 1626475..1627161 | - | 687 | WP_010357532.1 | hypothetical protein | - |
| NDN57_RS08395 (NDN57_008395) | 1627230..1627391 | - | 162 | WP_003691530.1 | hypothetical protein | - |
| NDN57_RS08400 (NDN57_008400) | 1627388..1627663 | - | 276 | WP_033911205.1 | hypothetical protein | - |
| NDN57_RS08405 (NDN57_008405) | 1627816..1628148 | - | 333 | WP_003695500.1 | hypothetical protein | - |
| NDN57_RS08410 (NDN57_008410) | 1628289..1628453 | - | 165 | WP_003700376.1 | hypothetical protein | - |
| NDN57_RS08415 (NDN57_008415) | 1628694..1629455 | + | 762 | WP_012503753.1 | hypothetical protein | - |
| NDN57_RS08420 (NDN57_008420) | 1629544..1629960 | - | 417 | WP_003700378.1 | hypothetical protein | - |
| NDN57_RS08425 (NDN57_008425) | 1629969..1630604 | - | 636 | WP_225602681.1 | Panacea domain-containing protein | - |
| NDN57_RS08430 (NDN57_008430) | 1630735..1631136 | - | 402 | WP_003691454.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| NDN57_RS08435 (NDN57_008435) | 1631238..1631420 | - | 183 | WP_003689143.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| NDN57_RS08440 (NDN57_008440) | 1631590..1632408 | - | 819 | WP_003693474.1 | DUF3037 domain-containing protein | - |
| NDN57_RS08445 (NDN57_008445) | 1632683..1633438 | - | 756 | WP_003693472.1 | LexA family transcriptional regulator | - |
| NDN57_RS08450 (NDN57_008450) | 1633575..1633760 | + | 186 | WP_002238713.1 | Cro/CI family transcriptional regulator | - |
| NDN57_RS08455 (NDN57_008455) | 1633849..1634004 | + | 156 | WP_003698902.1 | hypothetical protein | - |
| NDN57_RS08460 (NDN57_008460) | 1633981..1634169 | - | 189 | WP_003691445.1 | hypothetical protein | - |
| NDN57_RS08465 (NDN57_008465) | 1634342..1634569 | + | 228 | WP_003705596.1 | helix-turn-helix domain-containing protein | - |
| NDN57_RS08470 (NDN57_008470) | 1634566..1635078 | + | 513 | WP_033911191.1 | helix-turn-helix domain-containing protein | - |
| NDN57_RS08475 (NDN57_008475) | 1635092..1635610 | + | 519 | WP_025456213.1 | hypothetical protein | - |
| NDN57_RS08480 (NDN57_008480) | 1635625..1636404 | + | 780 | WP_025455898.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 1615170..1648516 | 33346 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6687.77 Da Isoelectric Point: 10.7235
>T260584 WP_003689143.1 NZ_CP107264:c1631420-1631238 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 14634.43 Da Isoelectric Point: 4.5457
>AT260584 WP_003691454.1 NZ_CP107264:c1631136-1630735 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|