Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1630735..1631420 Replicon chromosome
Accession NZ_CP107264
Organism Neisseria gonorrhoeae strain 10231

Toxin (Protein)


Gene name hicA Uniprot ID Q5F6D1
Locus tag NDN57_RS08435 Protein ID WP_003689143.1
Coordinates 1631238..1631420 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID Q5F6D2
Locus tag NDN57_RS08430 Protein ID WP_003691454.1
Coordinates 1630735..1631136 (-) Length 134 a.a.

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NDN57_RS08385 (NDN57_008385) 1626153..1626335 - 183 WP_003691535.1 hypothetical protein -
NDN57_RS08390 (NDN57_008390) 1626475..1627161 - 687 WP_010357532.1 hypothetical protein -
NDN57_RS08395 (NDN57_008395) 1627230..1627391 - 162 WP_003691530.1 hypothetical protein -
NDN57_RS08400 (NDN57_008400) 1627388..1627663 - 276 WP_033911205.1 hypothetical protein -
NDN57_RS08405 (NDN57_008405) 1627816..1628148 - 333 WP_003695500.1 hypothetical protein -
NDN57_RS08410 (NDN57_008410) 1628289..1628453 - 165 WP_003700376.1 hypothetical protein -
NDN57_RS08415 (NDN57_008415) 1628694..1629455 + 762 WP_012503753.1 hypothetical protein -
NDN57_RS08420 (NDN57_008420) 1629544..1629960 - 417 WP_003700378.1 hypothetical protein -
NDN57_RS08425 (NDN57_008425) 1629969..1630604 - 636 WP_225602681.1 Panacea domain-containing protein -
NDN57_RS08430 (NDN57_008430) 1630735..1631136 - 402 WP_003691454.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
NDN57_RS08435 (NDN57_008435) 1631238..1631420 - 183 WP_003689143.1 type II toxin-antitoxin system HicA family toxin Toxin
NDN57_RS08440 (NDN57_008440) 1631590..1632408 - 819 WP_003693474.1 DUF3037 domain-containing protein -
NDN57_RS08445 (NDN57_008445) 1632683..1633438 - 756 WP_003693472.1 LexA family transcriptional regulator -
NDN57_RS08450 (NDN57_008450) 1633575..1633760 + 186 WP_002238713.1 Cro/CI family transcriptional regulator -
NDN57_RS08455 (NDN57_008455) 1633849..1634004 + 156 WP_003698902.1 hypothetical protein -
NDN57_RS08460 (NDN57_008460) 1633981..1634169 - 189 WP_003691445.1 hypothetical protein -
NDN57_RS08465 (NDN57_008465) 1634342..1634569 + 228 WP_003705596.1 helix-turn-helix domain-containing protein -
NDN57_RS08470 (NDN57_008470) 1634566..1635078 + 513 WP_033911191.1 helix-turn-helix domain-containing protein -
NDN57_RS08475 (NDN57_008475) 1635092..1635610 + 519 WP_025456213.1 hypothetical protein -
NDN57_RS08480 (NDN57_008480) 1635625..1636404 + 780 WP_025455898.1 ATP-binding protein -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - - 1615170..1648516 33346


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.



Sequences


Toxin        


Download         Length: 61 a.a.        Molecular weight: 6687.77 Da        Isoelectric Point: 10.7235

>T260584 WP_003689143.1 NZ_CP107264:c1631420-1631238 [Neisseria gonorrhoeae]
MNSLDVIALLKQDGWYKVAQSGSHSQYKHPTKKGRVTVPHPKKDLPTGTVKNIYKQAGLK

Download         Length: 183 bp


Antitoxin


Download         Length: 134 a.a.        Molecular weight: 14634.43 Da        Isoelectric Point: 4.5457

>AT260584 WP_003691454.1 NZ_CP107264:c1631136-1630735 [Neisseria gonorrhoeae]
MFIPAALHKDEHSAYGVTIPDLPGCFSCGDTVEEAVANARSAAYMHIDGMIEDGGFKNLAVSSIADLSQEPDYHGATWVM
IEIDPAKISRQQIRFNVSWPQYLLDRVDEYTSANHETRSGFLAKAALLTMNQA

Download         Length: 402 bp


Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB Q5F6D1


Antitoxin

Source ID Structure
AlphaFold DB Q5F6D2

References