Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 951545..952200 | Replicon | chromosome |
Accession | NZ_CP107264 | ||
Organism | Neisseria gonorrhoeae strain 10231 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | Q5F882 |
Locus tag | NDN57_RS04895 | Protein ID | WP_003691083.1 |
Coordinates | 951545..951964 (-) | Length | 140 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | Q5F881 |
Locus tag | NDN57_RS04900 | Protein ID | WP_003688410.1 |
Coordinates | 951964..952200 (-) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NDN57_RS04875 (NDN57_004875) | 946779..948320 | - | 1542 | WP_003691084.1 | MDR family MFS transporter | - |
NDN57_RS04880 (NDN57_004880) | 948468..949247 | + | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
NDN57_RS04885 (NDN57_004885) | 949244..949945 | + | 702 | WP_003688414.1 | lactate utilization protein C | - |
NDN57_RS04890 (NDN57_004890) | 949942..951396 | + | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
NDN57_RS04895 (NDN57_004895) | 951545..951964 | - | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
NDN57_RS04900 (NDN57_004900) | 951964..952200 | - | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
NDN57_RS04905 (NDN57_004905) | 952647..953225 | - | 579 | WP_003697246.1 | IS3 family transposase | - |
NDN57_RS04910 (NDN57_004910) | 953230..953520 | - | 291 | WP_047917062.1 | helix-turn-helix domain-containing protein | - |
NDN57_RS04915 (NDN57_004915) | 953870..954256 | + | 387 | Protein_965 | IS110 family transposase | - |
NDN57_RS04920 (NDN57_004920) | 954639..955529 | - | 891 | WP_229930257.1 | succinate--CoA ligase subunit alpha | - |
NDN57_RS04925 (NDN57_004925) | 955540..956706 | - | 1167 | WP_003699872.1 | ADP-forming succinate--CoA ligase subunit beta | - |
NDN57_RS04930 (NDN57_004930) | 956778..957065 | - | 288 | WP_003688407.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T260583 WP_003691083.1 NZ_CP107264:c951964-951545 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|