Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 69837..70359 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP107263 | ||
| Organism | Leclercia adecarboxylata strain 2022CK-00320 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | - |
| Locus tag | N5937_RS24765 | Protein ID | WP_213802913.1 |
| Coordinates | 70075..70359 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | - |
| Locus tag | N5937_RS24760 | Protein ID | WP_213802912.1 |
| Coordinates | 69837..70085 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5937_RS24735 (N5937_24740) | 65474..66727 | + | 1254 | WP_263951682.1 | lactose permease | - |
| N5937_RS24740 (N5937_24745) | 66793..66933 | + | 141 | Protein_57 | galactoside O-acetyltransferase | - |
| N5937_RS24755 (N5937_24760) | 68668..69216 | + | 549 | WP_263951685.1 | hypothetical protein | - |
| N5937_RS24760 (N5937_24765) | 69837..70085 | + | 249 | WP_213802912.1 | plasmid stabilization protein | Antitoxin |
| N5937_RS24765 (N5937_24770) | 70075..70359 | + | 285 | WP_213802913.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N5937_RS24770 (N5937_24775) | 70402..71717 | - | 1316 | Protein_63 | ISNCY family transposase | - |
| N5937_RS24775 (N5937_24780) | 72012..72232 | - | 221 | Protein_64 | arsenate reductase | - |
| N5937_RS24780 (N5937_24785) | 72513..73052 | + | 540 | Protein_65 | DUF4113 domain-containing protein | - |
| N5937_RS24785 (N5937_24790) | 73399..74370 | - | 972 | WP_213802914.1 | ParB/RepB/Spo0J family plasmid partition protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..93413 | 93413 | |
| - | flank | IS/Tn | - | - | 67029..67322 | 293 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11063.83 Da Isoelectric Point: 10.5388
>T260582 WP_213802913.1 NZ_CP107263:70075-70359 [Leclercia adecarboxylata]
MTYKLAFNESALKEWKKLGHTLQMQFKKKLKERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYRVEDDIVTVTVIGVGK
RENDDIYNVTLNRN
MTYKLAFNESALKEWKKLGHTLQMQFKKKLKERLENPRVPASQLHGRKDQYKIKLRGAGYRLVYRVEDDIVTVTVIGVGK
RENDDIYNVTLNRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|