Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3515999..3516659 | Replicon | chromosome |
Accession | NZ_CP107262 | ||
Organism | Leclercia adecarboxylata strain 2022CK-00320 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | - |
Locus tag | N5937_RS17425 | Protein ID | WP_103176874.1 |
Coordinates | 3516246..3516659 (+) | Length | 138 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | - |
Locus tag | N5937_RS17420 | Protein ID | WP_103176875.1 |
Coordinates | 3515999..3516265 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5937_RS17395 (3511161) | 3511161..3512594 | - | 1434 | WP_156655195.1 | 6-phospho-beta-glucosidase BglA | - |
N5937_RS17400 (3512709) | 3512709..3513440 | - | 732 | WP_103176879.1 | MurR/RpiR family transcriptional regulator | - |
N5937_RS17405 (3513493) | 3513493..3513804 | + | 312 | WP_103176878.1 | N(4)-acetylcytidine aminohydrolase | - |
N5937_RS17410 (3513970) | 3513970..3514629 | + | 660 | WP_103176877.1 | hemolysin III family protein | - |
N5937_RS17415 (3514715) | 3514715..3515695 | - | 981 | WP_156655194.1 | tRNA-modifying protein YgfZ | - |
N5937_RS17420 (3515999) | 3515999..3516265 | + | 267 | WP_103176875.1 | FAD assembly factor SdhE | Antitoxin |
N5937_RS17425 (3516246) | 3516246..3516659 | + | 414 | WP_103176874.1 | protein YgfX | Toxin |
N5937_RS17430 (3516664) | 3516664..3517185 | - | 522 | WP_103176873.1 | flavodoxin FldB | - |
N5937_RS17435 (3517286) | 3517286..3518182 | + | 897 | WP_214422374.1 | site-specific tyrosine recombinase XerD | - |
N5937_RS17440 (3518204) | 3518204..3518917 | + | 714 | WP_263950284.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
N5937_RS17445 (3518923) | 3518923..3520656 | + | 1734 | WP_103176870.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 16236.07 Da Isoelectric Point: 10.7511
>T260577 WP_103176874.1 NZ_CP107262:3516246-3516659 [Leclercia adecarboxylata]
VVLWQSDLRVSWRAQWMSLLLHGLVAAVILLMPWPLSYTPLWLMLLSLVVFDSVRSQRRINARQGEIKLFMDSRLHWQES
EWEIVGTPWMLNSGMMLRLRKGAGQRCHHLWLAADSMDEAEWRDLRRMMSHQPTQGR
VVLWQSDLRVSWRAQWMSLLLHGLVAAVILLMPWPLSYTPLWLMLLSLVVFDSVRSQRRINARQGEIKLFMDSRLHWQES
EWEIVGTPWMLNSGMMLRLRKGAGQRCHHLWLAADSMDEAEWRDLRRMMSHQPTQGR
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|