Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 2191845..2192488 Replicon chromosome
Accession NZ_CP107262
Organism Leclercia adecarboxylata strain 2022CK-00320

Toxin (Protein)


Gene name vagD Uniprot ID -
Locus tag N5937_RS11090 Protein ID WP_103178020.1
Coordinates 2192072..2192488 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID -
Locus tag N5937_RS11085 Protein ID WP_021314452.1
Coordinates 2191845..2192075 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N5937_RS11050 (2187307) 2187307..2187606 - 300 WP_006810338.1 DUF4312 family protein -
N5937_RS11055 (2187609) 2187609..2187971 - 363 WP_006179053.1 SFCGS family glycine-rich protein -
N5937_RS11060 (2187982) 2187982..2188320 - 339 WP_103178022.1 glycine dehydrogenase -
N5937_RS11065 (2188787) 2188787..2189212 - 426 WP_103178021.1 glutaredoxin-dependent arsenate reductase -
N5937_RS11070 (2189225) 2189225..2190268 - 1044 Protein_2101 arsenic transporter -
N5937_RS11075 (2190417) 2190417..2190932 + 516 WP_032664851.1 hypothetical protein -
N5937_RS11080 (2191505) 2191505..2191734 - 230 Protein_2103 IS3 family transposase -
N5937_RS11085 (2191845) 2191845..2192075 + 231 WP_021314452.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
N5937_RS11090 (2192072) 2192072..2192488 + 417 WP_103178020.1 PIN domain-containing protein Toxin
N5937_RS11095 (2192634) 2192634..2193068 - 435 WP_159340462.1 hypothetical protein -
N5937_RS11100 (2193078) 2193078..2193464 - 387 WP_159340461.1 hypothetical protein -
N5937_RS11105 (2193583) 2193583..2193795 - 213 WP_263951559.1 hypothetical protein -
N5937_RS11110 (2194041) 2194041..2194469 - 429 WP_159340459.1 hypothetical protein -
N5937_RS11115 (2194545) 2194545..2194886 - 342 WP_263951561.1 hypothetical protein -
N5937_RS11120 (2195061) 2195061..2195504 - 444 WP_263951562.1 hypothetical protein -
N5937_RS11125 (2195505) 2195505..2195690 + 186 WP_159340456.1 hypothetical protein -
N5937_RS11130 (2195772) 2195772..2196152 - 381 WP_159340455.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 2188787..2201512 12725


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-52)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 14919.30 Da        Isoelectric Point: 7.1356

>T260574 WP_103178020.1 NZ_CP107262:2192072-2192488 [Leclercia adecarboxylata]
VIKTYMLDTNICSFIMREQPEAVIKRLEQAVLRNNRIVVSAITYAEMRFGAIGKKASPRHGMLVEAFCARLDAILAWDRA
AVDATTEIKAALTAAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWAN

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8671.72 Da        Isoelectric Point: 4.4563

>AT260574 WP_021314452.1 NZ_CP107262:2191845-2192075 [Leclercia adecarboxylata]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFTQLEKADSDFMAERGDVVSDEGRFDL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References