Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 2179123..2179639 | Replicon | chromosome |
Accession | NZ_CP107262 | ||
Organism | Leclercia adecarboxylata strain 2022CK-00320 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | N5937_RS11005 | Protein ID | WP_103178030.1 |
Coordinates | 2179123..2179407 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | N5937_RS11010 | Protein ID | WP_103178029.1 |
Coordinates | 2179397..2179639 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5937_RS10990 (2174384) | 2174384..2176039 | + | 1656 | WP_263951550.1 | alpha,alpha-phosphotrehalase | - |
N5937_RS10995 (2176410) | 2176410..2178548 | + | 2139 | WP_263951551.1 | anaerobic ribonucleoside-triphosphate reductase | - |
N5937_RS11000 (2178655) | 2178655..2179119 | + | 465 | WP_263951552.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
N5937_RS11005 (2179123) | 2179123..2179407 | - | 285 | WP_103178030.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5937_RS11010 (2179397) | 2179397..2179639 | - | 243 | WP_103178029.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N5937_RS11015 (2179717) | 2179717..2181627 | - | 1911 | WP_159340183.1 | PRD domain-containing protein | - |
N5937_RS11020 (2181647) | 2181647..2182783 | - | 1137 | WP_263951554.1 | lactonase family protein | - |
N5937_RS11025 (2182838) | 2182838..2183578 | - | 741 | WP_263951555.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10898.68 Da Isoelectric Point: 10.4610
>T260573 WP_103178030.1 NZ_CP107262:c2179407-2179123 [Leclercia adecarboxylata]
MTYELEFDPRALKEWQKLGDTVKSQFKKKLAVVLSNPRRESARLHGLPDCYKIKLSSSGYRLVYQVRDKVITVFVVAVGK
REKSAVYHDANQRL
MTYELEFDPRALKEWQKLGDTVKSQFKKKLAVVLSNPRRESARLHGLPDCYKIKLSSSGYRLVYQVRDKVITVFVVAVGK
REKSAVYHDANQRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|