Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 1383193..1383812 | Replicon | chromosome |
| Accession | NZ_CP107262 | ||
| Organism | Leclercia adecarboxylata strain 2022CK-00320 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | A0A345CDT0 |
| Locus tag | N5937_RS07110 | Protein ID | WP_032616864.1 |
| Coordinates | 1383594..1383812 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | - |
| Locus tag | N5937_RS07105 | Protein ID | WP_103178503.1 |
| Coordinates | 1383193..1383585 (+) | Length | 131 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N5937_RS07095 (1378347) | 1378347..1379540 | + | 1194 | WP_156654007.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| N5937_RS07100 (1379563) | 1379563..1382703 | + | 3141 | WP_103178504.1 | multidrug efflux RND transporter permease subunit AcrB | - |
| N5937_RS07105 (1383193) | 1383193..1383585 | + | 393 | WP_103178503.1 | Hha toxicity modulator TomB | Antitoxin |
| N5937_RS07110 (1383594) | 1383594..1383812 | + | 219 | WP_032616864.1 | HHA domain-containing protein | Toxin |
| N5937_RS07115 (1384076) | 1384076..1384540 | + | 465 | WP_103178502.1 | YlaC family protein | - |
| N5937_RS07120 (1384590) | 1384590..1384730 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
| N5937_RS07125 (1384988) | 1384988..1386556 | + | 1569 | WP_263951259.1 | EAL domain-containing protein | - |
| N5937_RS07130 (1386589) | 1386589..1386942 | - | 354 | WP_103178500.1 | DUF1428 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8583.95 Da Isoelectric Point: 8.9008
>T260570 WP_032616864.1 NZ_CP107262:1383594-1383812 [Leclercia adecarboxylata]
MSDKPLTKTDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTAVWKFVR
MSDKPLTKTDYLMRLRRCQSIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTAVWKFVR
Download Length: 219 bp
Antitoxin
Download Length: 131 a.a. Molecular weight: 15150.05 Da Isoelectric Point: 4.8941
>AT260570 WP_103178503.1 NZ_CP107262:1383193-1383585 [Leclercia adecarboxylata]
MDEYSPKRQDIAQLKFLCESLYHDCLTNLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNASRANPLASPIKIITNN
MDEYSPKRQDIAQLKFLCESLYHDCLTNLDESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINAQDLQKWRKSGNRLFRCFVNASRANPLASPIKIITNN
Download Length: 393 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|