Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE-RelB |
Location | 2547353..2547926 | Replicon | chromosome |
Accession | NZ_CP107257 | ||
Organism | Pseudomonas aeruginosa strain 2019CK-00034 |
Toxin (Protein)
Gene name | relE | Uniprot ID | W5IUR0 |
Locus tag | N5938_RS11825 | Protein ID | WP_009618209.1 |
Coordinates | 2547639..2547926 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | W5ISI7 |
Locus tag | N5938_RS11820 | Protein ID | WP_009618210.1 |
Coordinates | 2547353..2547652 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5938_RS11790 (N5938_11790) | 2542455..2542673 | + | 219 | WP_011829925.1 | AlpA family transcriptional regulator | - |
N5938_RS11795 (N5938_11795) | 2542714..2543581 | + | 868 | Protein_2315 | ParA family protein | - |
N5938_RS11800 (N5938_11800) | 2543565..2543801 | + | 237 | WP_013982111.1 | type II toxin-antitoxin system HicA family toxin | - |
N5938_RS11805 (N5938_11805) | 2543794..2545451 | + | 1658 | Protein_2317 | ParB family protein | - |
N5938_RS11810 (N5938_11810) | 2545469..2546029 | + | 561 | WP_018076214.1 | DUF2857 domain-containing protein | - |
N5938_RS11815 (N5938_11815) | 2546032..2547251 | + | 1220 | Protein_2319 | STY4528 family pathogenicity island replication protein | - |
N5938_RS11820 (N5938_11820) | 2547353..2547652 | + | 300 | WP_009618210.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
N5938_RS11825 (N5938_11825) | 2547639..2547926 | + | 288 | WP_009618209.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
N5938_RS11830 (N5938_11830) | 2547955..2548146 | + | 192 | WP_011805449.1 | hypothetical protein | - |
N5938_RS11835 (N5938_11835) | 2548270..2549049 | + | 780 | WP_017244811.1 | TIGR03761 family integrating conjugative element protein | - |
N5938_RS11840 (N5938_11840) | 2549030..2549593 | + | 564 | WP_263901907.1 | DUF3158 family protein | - |
N5938_RS11845 (N5938_11845) | 2549590..2550039 | + | 450 | WP_119163122.1 | single-stranded DNA-binding protein | - |
N5938_RS11850 (N5938_11850) | 2550322..2552337 | + | 2016 | WP_003141052.1 | DNA topoisomerase III | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10854.46 Da Isoelectric Point: 8.4628
>T260564 WP_009618209.1 NZ_CP107257:2547639-2547926 [Pseudomonas aeruginosa]
VRVLEWREAARADLLAIVDYISDDNPDAAQRLKDDIEAKAAKLPERPKLYRPGRVAGTREMVVRANYVVVYMEDTRAVSI
LRVLHAAQQWPPARE
VRVLEWREAARADLLAIVDYISDDNPDAAQRLKDDIEAKAAKLPERPKLYRPGRVAGTREMVVRANYVVVYMEDTRAVSI
LRVLHAAQQWPPARE
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5R9QF16 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5R9QE11 |