Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 789358..789863 | Replicon | chromosome |
Accession | NZ_CP107257 | ||
Organism | Pseudomonas aeruginosa strain 2019CK-00034 |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | N5938_RS03725 | Protein ID | WP_003083773.1 |
Coordinates | 789582..789863 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | N5938_RS03720 | Protein ID | WP_003083775.1 |
Coordinates | 789358..789585 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N5938_RS03695 (N5938_03695) | 784388..785881 | + | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
N5938_RS03700 (N5938_03700) | 786050..787465 | + | 1416 | WP_263901831.1 | GABA permease | - |
N5938_RS03705 (N5938_03705) | 787547..787888 | - | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
N5938_RS03710 (N5938_03710) | 787961..788461 | - | 501 | WP_003101228.1 | LEA type 2 family protein | - |
N5938_RS03715 (N5938_03715) | 788562..789182 | + | 621 | WP_023092259.1 | hypothetical protein | - |
N5938_RS03720 (N5938_03720) | 789358..789585 | + | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
N5938_RS03725 (N5938_03725) | 789582..789863 | + | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
N5938_RS03730 (N5938_03730) | 790163..791071 | + | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
N5938_RS03735 (N5938_03735) | 791103..791513 | - | 411 | WP_003110659.1 | aegerolysin family protein | - |
N5938_RS03740 (N5938_03740) | 791693..792427 | - | 735 | WP_003083764.1 | GntR family transcriptional regulator | - |
N5938_RS03745 (N5938_03745) | 792528..793214 | - | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
N5938_RS03750 (N5938_03750) | 793263..794612 | - | 1350 | WP_003137006.1 | C4-dicarboxylate transporter DctA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T260562 WP_003083773.1 NZ_CP107257:789582-789863 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|