Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-yefM/Txe-RelB
Location 1869436..1869965 Replicon chromosome
Accession NZ_CP107247
Organism Coxiella burnetii strain KZQ3

Toxin (Protein)


Gene name relE Uniprot ID Q83AB3
Locus tag OHM78_RS10195 Protein ID WP_005769718.1
Coordinates 1869690..1869965 (+) Length 92 a.a.

Antitoxin (Protein)


Gene name yefM Uniprot ID Q83AB4
Locus tag OHM78_RS10190 Protein ID WP_005769716.1
Coordinates 1869436..1869690 (+) Length 85 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OHM78_RS10145 (OHM78_10145) 1864504..1864878 + 375 WP_005769706.1 hypothetical protein -
OHM78_RS10150 (OHM78_10150) 1864923..1865621 + 699 WP_010958581.1 outer membrane beta-barrel protein -
OHM78_RS10155 (OHM78_10155) 1865685..1866626 + 942 WP_005769709.1 S49 family peptidase -
OHM78_RS10160 (OHM78_10160) 1866639..1867514 + 876 WP_005769711.1 symmetrical bis(5'-nucleosyl)-tetraphosphatase -
OHM78_RS10165 (OHM78_10165) 1867490..1867594 + 105 WP_230578142.1 type II toxin-antitoxin system YoeB family toxin -
OHM78_RS10170 (OHM78_10170) 1867663..1867797 + 135 WP_010958583.1 hypothetical protein -
OHM78_RS10175 (OHM78_10175) 1867958..1868977 + 1020 WP_263715589.1 IS110-like element IS1111A family transposase -
OHM78_RS10180 (OHM78_10180) 1868974..1869246 - 273 WP_005768315.1 hypothetical protein -
OHM78_RS10185 (OHM78_10185) 1869247..1869375 + 129 WP_230578144.1 hypothetical protein -
OHM78_RS10190 (OHM78_10190) 1869436..1869690 + 255 WP_005769716.1 type II toxin-antitoxin system prevent-host-death family antitoxin Antitoxin
OHM78_RS10195 (OHM78_10195) 1869690..1869965 + 276 WP_005769718.1 Txe/YoeB family addiction module toxin Toxin
OHM78_RS10200 (OHM78_10200) 1869938..1870423 - 486 WP_005769725.1 dihydrofolate reductase -
OHM78_RS10205 (OHM78_10205) 1870420..1871223 - 804 WP_238024516.1 epoxyqueuosine reductase QueH -
OHM78_RS10210 (OHM78_10210) 1871419..1871706 + 288 WP_005769730.1 acylphosphatase -
OHM78_RS10215 (OHM78_10215) 1871682..1872236 - 555 WP_005769732.1 D-glycero-beta-D-manno-heptose 1,7-bisphosphate 7-phosphatase -
OHM78_RS10220 (OHM78_10220) 1872249..1873193 - 945 WP_238024517.1 methionyl-tRNA formyltransferase -
OHM78_RS10225 (OHM78_10225) 1873381..1874307 + 927 WP_012570936.1 DNA-processing protein DprA -
OHM78_RS10230 (OHM78_10230) 1874304..1874783 + 480 WP_011997413.1 DUF494 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1867958..1868977 1019


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin YoeB

(5-84)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-74)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 11150.86 Da        Isoelectric Point: 9.6762

>T260561 WP_005769718.1 NZ_CP107247:1869690-1869965 [Coxiella burnetii]
MQISFTPEAWEDYLYWQKFDKKMLRRINELIKDAMHEPFSGKGKPEPLKFELQGYWSRRLDQEHRLVYKVLDDSLMIIAA
RFHYNRLNSKN

Download         Length: 276 bp

Antitoxin


Download         Length: 85 a.a.        Molecular weight: 9624.25 Da        Isoelectric Point: 10.4802

>AT260561 WP_005769716.1 NZ_CP107247:1869436-1869690 [Coxiella burnetii]
MNVVTFSELRAQLKKILDLSADQHEPVVVKRPNKETMVILSLRDFEALKETAYLLSNEANAARLRQSIRSLKQGKAQKKK
LMED

Download         Length: 255 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q83AB3

Antitoxin

Source ID Structure
AlphaFold DB Q83AB4

References