Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 4697606..4698230 | Replicon | chromosome |
Accession | NZ_CP107244 | ||
Organism | Achromobacter sp. SS2-2022 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | N3Z32_RS21105 | Protein ID | WP_268079350.1 |
Coordinates | 4697606..4697788 (+) | Length | 61 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | N3Z32_RS21110 | Protein ID | WP_268079351.1 |
Coordinates | 4697838..4698230 (+) | Length | 131 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N3Z32_RS21075 (N3Z32_21090) | 4693417..4694286 | - | 870 | WP_268079346.1 | alpha/beta hydrolase | - |
N3Z32_RS21080 (N3Z32_21095) | 4694537..4695454 | - | 918 | WP_268079347.1 | DUF808 domain-containing protein | - |
N3Z32_RS21085 (N3Z32_21100) | 4695647..4695904 | - | 258 | WP_259251979.1 | hypothetical protein | - |
N3Z32_RS21090 (N3Z32_21105) | 4695973..4696176 | - | 204 | WP_050448526.1 | cold-shock protein | - |
N3Z32_RS21095 (N3Z32_21110) | 4696640..4697077 | + | 438 | WP_268079348.1 | hypothetical protein | - |
N3Z32_RS21100 (N3Z32_21115) | 4697096..4697437 | - | 342 | WP_268079349.1 | hypothetical protein | - |
N3Z32_RS21105 (N3Z32_21120) | 4697606..4697788 | + | 183 | WP_268079350.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
N3Z32_RS21110 (N3Z32_21125) | 4697838..4698230 | + | 393 | WP_268079351.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
N3Z32_RS21115 (N3Z32_21130) | 4698271..4699011 | - | 741 | WP_268079352.1 | SDR family oxidoreductase | - |
N3Z32_RS21120 (N3Z32_21135) | 4699049..4700389 | - | 1341 | WP_277549605.1 | CitMHS family transporter | - |
N3Z32_RS21125 (N3Z32_21140) | 4700579..4701283 | + | 705 | WP_268079353.1 | response regulator transcription factor | - |
N3Z32_RS21130 (N3Z32_21145) | 4701287..4702741 | + | 1455 | WP_268079354.1 | sensor histidine kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6765.99 Da Isoelectric Point: 12.1585
>T260558 WP_268079350.1 NZ_CP107244:4697606-4697788 [Achromobacter sp. SS2-2022]
MNSREIIRQLRQAGWVFRHAKGSHHIFVHPQKPGHISVPHPKKDLGIGLVTKLLTQAGLK
MNSREIIRQLRQAGWVFRHAKGSHHIFVHPQKPGHISVPHPKKDLGIGLVTKLLTQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 131 a.a. Molecular weight: 13915.77 Da Isoelectric Point: 4.2687
>AT260558 WP_268079351.1 NZ_CP107244:4697838-4698230 [Achromobacter sp. SS2-2022]
MKYPIAIEPGSETQAWGVVVPDLPGCFSAADSGIDEAIENAKEAIELWIETALDSGTPVPVATSIAGHQANPEFAGWIWA
IVEIDPAVMDDTIERINITLPRRILARIDAKARAAGESRSGYIAHLALTH
MKYPIAIEPGSETQAWGVVVPDLPGCFSAADSGIDEAIENAKEAIELWIETALDSGTPVPVATSIAGHQANPEFAGWIWA
IVEIDPAVMDDTIERINITLPRRILARIDAKARAAGESRSGYIAHLALTH
Download Length: 393 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|