Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 2460183..2460850 | Replicon | chromosome |
| Accession | NZ_CP107244 | ||
| Organism | Achromobacter sp. SS2-2022 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | N3Z32_RS11125 | Protein ID | WP_268077631.1 |
| Coordinates | 2460183..2460602 (-) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | N3Z32_RS11130 | Protein ID | WP_268077632.1 |
| Coordinates | 2460599..2460850 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N3Z32_RS11100 (N3Z32_11100) | 2455937..2456896 | - | 960 | WP_268077626.1 | DMT family transporter | - |
| N3Z32_RS11105 (N3Z32_11105) | 2456978..2457847 | - | 870 | WP_268077627.1 | AraC family transcriptional regulator | - |
| N3Z32_RS11110 (N3Z32_11110) | 2457934..2459208 | - | 1275 | WP_268077628.1 | RNA polymerase sigma factor | - |
| N3Z32_RS11115 (N3Z32_11115) | 2459205..2459612 | - | 408 | WP_268077629.1 | VOC family protein | - |
| N3Z32_RS11120 (N3Z32_11120) | 2459631..2460041 | - | 411 | WP_268077630.1 | YciI family protein | - |
| N3Z32_RS11125 (N3Z32_11125) | 2460183..2460602 | - | 420 | WP_268077631.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| N3Z32_RS11130 (N3Z32_11130) | 2460599..2460850 | - | 252 | WP_268077632.1 | Arc family DNA-binding protein | Antitoxin |
| N3Z32_RS11135 (N3Z32_11135) | 2460951..2461304 | - | 354 | WP_268077633.1 | YciI family protein | - |
| N3Z32_RS11140 (N3Z32_11140) | 2461468..2462451 | - | 984 | WP_268077634.1 | OmpA family protein | - |
| N3Z32_RS11145 (N3Z32_11145) | 2462448..2463347 | - | 900 | WP_268077635.1 | MotA/TolQ/ExbB proton channel family protein | - |
| N3Z32_RS11150 (N3Z32_11150) | 2463645..2465612 | + | 1968 | WP_268077636.1 | NYN domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 14660.88 Da Isoelectric Point: 4.8181
>T260557 WP_268077631.1 NZ_CP107244:c2460602-2460183 [Achromobacter sp. SS2-2022]
MILLDTNVISEPLRQAPADAVIEWIDRQPLETLFLSAVTVAELRFGVACMPVGKRRDALHGDLEQRVLALFAGRILAFDT
SASLEYVALMARARASGQAIGGPDGYIAATAAAHGMSVATRDVAPFEAAGVSVINPWGA
MILLDTNVISEPLRQAPADAVIEWIDRQPLETLFLSAVTVAELRFGVACMPVGKRRDALHGDLEQRVLALFAGRILAFDT
SASLEYVALMARARASGQAIGGPDGYIAATAAAHGMSVATRDVAPFEAAGVSVINPWGA
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|