Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 1503289..1503884 Replicon chromosome
Accession NZ_CP107244
Organism Achromobacter sp. SS2-2022

Toxin (Protein)


Gene name hicA Uniprot ID -
Locus tag N3Z32_RS06795 Protein ID WP_268081866.1
Coordinates 1503702..1503884 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag N3Z32_RS06790 Protein ID WP_268081865.1
Coordinates 1503289..1503678 (-) Length 130 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N3Z32_RS06760 (N3Z32_06760) 1498430..1499401 + 972 WP_268081860.1 tripartite tricarboxylate transporter substrate binding protein -
N3Z32_RS06765 (N3Z32_06765) 1499569..1500519 - 951 WP_268081861.1 nitronate monooxygenase -
N3Z32_RS06770 (N3Z32_06770) 1500740..1501567 + 828 WP_268081862.1 hypothetical protein -
N3Z32_RS06775 (N3Z32_06775) 1501938..1502276 + 339 WP_268081863.1 hypothetical protein -
N3Z32_RS06780 (N3Z32_06780) 1502501..1502704 + 204 WP_172616244.1 cold-shock protein -
N3Z32_RS06785 (N3Z32_06785) 1502818..1503201 - 384 WP_268081864.1 GFA family protein -
N3Z32_RS06790 (N3Z32_06790) 1503289..1503678 - 390 WP_268081865.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
N3Z32_RS06795 (N3Z32_06795) 1503702..1503884 - 183 WP_268081866.1 type II toxin-antitoxin system HicA family toxin Toxin
N3Z32_RS06800 (N3Z32_06800) 1503987..1505399 - 1413 WP_268081867.1 3-carboxy-cis,cis-muconate cycloisomerase -
N3Z32_RS06805 (N3Z32_06805) 1505421..1505999 - 579 WP_268081868.1 protocatechuate 3,4-dioxygenase subunit alpha -
N3Z32_RS06810 (N3Z32_06810) 1506003..1506704 - 702 WP_268081869.1 protocatechuate 3,4-dioxygenase subunit beta -
N3Z32_RS06815 (N3Z32_06815) 1506769..1508049 - 1281 WP_268081870.1 TRAP transporter large permease subunit -
N3Z32_RS06820 (N3Z32_06820) 1508046..1508621 - 576 WP_268081871.1 TRAP transporter small permease -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(4-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-122)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6728.84 Da        Isoelectric Point: 11.4487

>T260556 WP_268081866.1 NZ_CP107244:c1503884-1503702 [Achromobacter sp. SS2-2022]
MNSADIIKRLKADGWYLVHSVGSHHQFKHPTKRGKVTVPHPRKDLPAPTAHSILKQAGLR

Download         Length: 183 bp

Antitoxin


Download         Length: 130 a.a.        Molecular weight: 14135.17 Da        Isoelectric Point: 6.6400

>AT260556 WP_268081865.1 NZ_CP107244:c1503678-1503289 [Achromobacter sp. SS2-2022]
VLYLIYVHKEKGSAYGASFPDFPGCHAAATTLQELPSAAQEAVEAHFFGETQPIPSPSAPDVWMQKKAFQGGFWMLVDID
LSKVNTKAVRLNISLPENLVHRIDAVARARRLSRSAFLALAAEHEMEAA

Download         Length: 390 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References