Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 707360..707887 | Replicon | chromosome |
| Accession | NZ_CP107244 | ||
| Organism | Achromobacter sp. SS2-2022 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | N3Z32_RS03195 | Protein ID | WP_268081220.1 |
| Coordinates | 707612..707887 (+) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | N3Z32_RS03190 | Protein ID | WP_268081219.1 |
| Coordinates | 707360..707578 (+) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N3Z32_RS03160 (N3Z32_03160) | 702796..703182 | + | 387 | WP_268081213.1 | DUF6152 family protein | - |
| N3Z32_RS03165 (N3Z32_03165) | 703201..703686 | + | 486 | WP_268081214.1 | DUF2214 domain-containing protein | - |
| N3Z32_RS03170 (N3Z32_03170) | 703735..704022 | - | 288 | WP_268081215.1 | cytochrome c | - |
| N3Z32_RS03175 (N3Z32_03175) | 704123..705361 | - | 1239 | WP_268081216.1 | sulfite oxidase | - |
| N3Z32_RS03180 (N3Z32_03180) | 705611..706558 | - | 948 | WP_268081217.1 | sensor domain-containing diguanylate cyclase | - |
| N3Z32_RS03185 (N3Z32_03185) | 706576..707034 | - | 459 | WP_268081218.1 | hypothetical protein | - |
| N3Z32_RS03190 (N3Z32_03190) | 707360..707578 | + | 219 | WP_268081219.1 | stability determinant | Antitoxin |
| N3Z32_RS03195 (N3Z32_03195) | 707612..707887 | + | 276 | WP_268081220.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| N3Z32_RS03200 (N3Z32_03200) | 707914..708903 | - | 990 | WP_268082350.1 | LysR family transcriptional regulator | - |
| N3Z32_RS03205 (N3Z32_03205) | 709099..710265 | + | 1167 | WP_268082351.1 | CoA transferase | - |
| N3Z32_RS03210 (N3Z32_03210) | 710265..711329 | + | 1065 | WP_268081221.1 | NADPH:quinone oxidoreductase family protein | - |
| N3Z32_RS03215 (N3Z32_03215) | 711278..712303 | + | 1026 | WP_268081222.1 | tripartite tricarboxylate transporter substrate binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10350.74 Da Isoelectric Point: 5.0264
>T260555 WP_268081220.1 NZ_CP107244:707612-707887 [Achromobacter sp. SS2-2022]
MLPIFWSASALDDLDEITNYIAEYDVHAAIGMHELIENAVHPASEHPYLYRPGRVPGTREIVAHPNYILVYEVRADHIGV
IAVMHARQEYP
MLPIFWSASALDDLDEITNYIAEYDVHAAIGMHELIENAVHPASEHPYLYRPGRVPGTREIVAHPNYILVYEVRADHIGV
IAVMHARQEYP
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|