Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RHH |
| Location | 16881..17434 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107242 | ||
| Organism | Xanthomonas hortorum strain Oregano 108 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OEG85_RS24300 | Protein ID | WP_268215277.1 |
| Coordinates | 16881..17174 (-) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | OEG85_RS24305 | Protein ID | WP_231673701.1 |
| Coordinates | 17162..17434 (-) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OEG85_RS24265 (OEG85_24260) | 12225..12455 | - | 231 | WP_268215273.1 | entry exclusion lipoprotein TrbK | - |
| OEG85_RS24270 (OEG85_24265) | 12468..13253 | - | 786 | WP_180316227.1 | P-type conjugative transfer protein TrbJ | - |
| OEG85_RS24275 (OEG85_24270) | 13425..13805 | - | 381 | WP_268215274.1 | hypothetical protein | - |
| OEG85_RS24280 (OEG85_24275) | 14015..14383 | + | 369 | WP_268215275.1 | plasmid mobilization relaxosome protein MobC | - |
| OEG85_RS24285 (OEG85_24280) | 14380..16272 | + | 1893 | WP_268215276.1 | hypothetical protein | - |
| OEG85_RS24290 (OEG85_24285) | 16288..16596 | + | 309 | WP_180316223.1 | hypothetical protein | - |
| OEG85_RS24295 (OEG85_24290) | 16611..16868 | - | 258 | WP_180316222.1 | XRE family transcriptional regulator | - |
| OEG85_RS24300 (OEG85_24295) | 16881..17174 | - | 294 | WP_268215277.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OEG85_RS24305 (OEG85_24300) | 17162..17434 | - | 273 | WP_231673701.1 | CopG family ribbon-helix-helix protein | Antitoxin |
| OEG85_RS24310 (OEG85_24305) | 17670..17906 | + | 237 | WP_268215278.1 | hypothetical protein | - |
| OEG85_RS24315 (OEG85_24310) | 17896..18543 | + | 648 | WP_268215279.1 | recombinase family protein | - |
| OEG85_RS24320 (OEG85_24315) | 18540..18677 | + | 138 | WP_208591887.1 | hypothetical protein | - |
| OEG85_RS24325 (OEG85_24320) | 18789..19421 | + | 633 | WP_002804299.1 | ParA family protein | - |
| OEG85_RS24330 (OEG85_24325) | 19414..19776 | + | 363 | WP_268215280.1 | hypothetical protein | - |
| OEG85_RS24335 (OEG85_24330) | 19859..20182 | + | 324 | WP_002804301.1 | ParC family partition-associated protein | - |
| OEG85_RS24340 (OEG85_24335) | 20373..21818 | + | 1446 | WP_268215281.1 | replication protein | - |
| OEG85_RS24345 (OEG85_24340) | 22066..22377 | + | 312 | WP_268215282.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..62884 | 62884 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10777.35 Da Isoelectric Point: 6.4636
>T260553 WP_268215277.1 NZ_CP107242:c17174-16881 [Xanthomonas hortorum]
VPQVIVTEGAAQGLERCRRFLAAKAPEAAQRAGQAIERQFLLLEKSPDIGRPFPELPELRELVIAFGDSGYVALYRHEPA
ADAVYVLAFRHQKEVGY
VPQVIVTEGAAQGLERCRRFLAAKAPEAAQRAGQAIERQFLLLEKSPDIGRPFPELPELRELVIAFGDSGYVALYRHEPA
ADAVYVLAFRHQKEVGY
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|