Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
Location | 4917802..4918415 | Replicon | chromosome |
Accession | NZ_CP107241 | ||
Organism | Xanthomonas hortorum strain Oregano 108 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OEG85_RS21235 | Protein ID | WP_268212924.1 |
Coordinates | 4918116..4918415 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OEG85_RS21230 | Protein ID | WP_268212923.1 |
Coordinates | 4917802..4918119 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEG85_RS21210 (OEG85_21205) | 4913831..4914193 | - | 363 | WP_223647394.1 | hypothetical protein | - |
OEG85_RS21215 (OEG85_21210) | 4914331..4916076 | - | 1746 | WP_268212921.1 | ATP-binding protein | - |
OEG85_RS21220 (OEG85_21215) | 4916073..4917329 | - | 1257 | WP_223647390.1 | SIR2 family protein | - |
OEG85_RS21225 (OEG85_21220) | 4917434..4917646 | - | 213 | WP_268212922.1 | hypothetical protein | - |
OEG85_RS21230 (OEG85_21225) | 4917802..4918119 | - | 318 | WP_268212923.1 | putative addiction module antidote protein | Antitoxin |
OEG85_RS21235 (OEG85_21230) | 4918116..4918415 | - | 300 | WP_268212924.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OEG85_RS21240 (OEG85_21235) | 4918618..4918818 | + | 201 | WP_268215220.1 | antitoxin VbhA family protein | - |
OEG85_RS21245 (OEG85_21240) | 4918863..4919967 | + | 1105 | Protein_4165 | IS3 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4899182..4935072 | 35890 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11219.92 Da Isoelectric Point: 9.5610
>T260551 WP_268212924.1 NZ_CP107241:c4918415-4918116 [Xanthomonas hortorum]
MAYTVKQLDEFSGWLRGLKDGLTRQRLIKRLRKVQLGNLGDVEPVGEGVFEMREHFGPGWRMYYVQHGELVIVMLGGGDK
STQQADIRRATALAKSLED
MAYTVKQLDEFSGWLRGLKDGLTRQRLIKRLRKVQLGNLGDVEPVGEGVFEMREHFGPGWRMYYVQHGELVIVMLGGGDK
STQQADIRRATALAKSLED
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|