Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/Phd(antitoxin) |
Location | 98393..98937 | Replicon | chromosome |
Accession | NZ_CP107241 | ||
Organism | Xanthomonas hortorum strain Oregano 108 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OEG85_RS00380 | Protein ID | WP_268213524.1 |
Coordinates | 98638..98937 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OEG85_RS00375 | Protein ID | WP_115036791.1 |
Coordinates | 98393..98650 (+) | Length | 86 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OEG85_RS00365 (OEG85_00365) | 94991..97486 | - | 2496 | WP_268213522.1 | DEAD/DEAH box helicase | - |
OEG85_RS00370 (OEG85_00370) | 97663..98325 | + | 663 | WP_162498205.1 | hemolysin III family protein | - |
OEG85_RS00375 (OEG85_00375) | 98393..98650 | + | 258 | WP_115036791.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OEG85_RS00380 (OEG85_00380) | 98638..98937 | + | 300 | WP_268213524.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OEG85_RS00385 (OEG85_00385) | 98996..99520 | - | 525 | WP_268213525.1 | hypothetical protein | - |
OEG85_RS00390 (OEG85_00390) | 99631..100587 | + | 957 | WP_009597007.1 | IS30 family transposase | - |
OEG85_RS00395 (OEG85_00395) | 100771..101229 | - | 459 | WP_268213526.1 | helix-turn-helix domain-containing protein | - |
OEG85_RS00400 (OEG85_00400) | 101449..102252 | + | 804 | WP_268213527.1 | SDR family NAD(P)-dependent oxidoreductase | - |
OEG85_RS00405 (OEG85_00405) | 102367..102663 | + | 297 | WP_268213529.1 | YciI family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 99631..100587 | 956 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11453.22 Da Isoelectric Point: 9.0225
>T260548 WP_268213524.1 NZ_CP107241:98638-98937 [Xanthomonas hortorum]
MAEIVWSEPALADLDVIADYIAIEDALAAATLVRRVFAHVEQLIEHPESGSRPQELKRSRYRQIVEPPCRVFYRVDGQRI
VVVHVMRSERSLRKSRLSR
MAEIVWSEPALADLDVIADYIAIEDALAAATLVRRVFAHVEQLIEHPESGSRPQELKRSRYRQIVEPPCRVFYRVDGQRI
VVVHVMRSERSLRKSRLSR
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|