Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 723347..724002 | Replicon | chromosome |
| Accession | NZ_CP107223 | ||
| Organism | Neisseria gonorrhoeae strain H035 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | Q5F882 |
| Locus tag | OE961_RS03865 | Protein ID | WP_003691083.1 |
| Coordinates | 723583..724002 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | Q5F881 |
| Locus tag | OE961_RS03860 | Protein ID | WP_003688410.1 |
| Coordinates | 723347..723583 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OE961_RS03830 (OE961_03830) | 718481..718768 | + | 288 | WP_003688407.1 | hypothetical protein | - |
| OE961_RS03835 (OE961_03835) | 718840..720006 | + | 1167 | WP_003688408.1 | ADP-forming succinate--CoA ligase subunit beta | - |
| OE961_RS03840 (OE961_03840) | 720017..720907 | + | 891 | WP_002244992.1 | succinate--CoA ligase subunit alpha | - |
| OE961_RS03845 (OE961_03845) | 721290..721676 | - | 387 | Protein_745 | transposase | - |
| OE961_RS03850 (OE961_03850) | 722026..722316 | + | 291 | WP_041420764.1 | helix-turn-helix domain-containing protein | - |
| OE961_RS03855 (OE961_03855) | 722321..722899 | + | 579 | WP_003688041.1 | IS3 family transposase | - |
| OE961_RS03860 (OE961_03860) | 723347..723583 | + | 237 | WP_003688410.1 | type II toxin-antitoxin system antitoxin FitA | Antitoxin |
| OE961_RS03865 (OE961_03865) | 723583..724002 | + | 420 | WP_003691083.1 | type II toxin-antitoxin system toxin FitB | Toxin |
| OE961_RS03870 (OE961_03870) | 724151..725605 | - | 1455 | WP_003688412.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
| OE961_RS03875 (OE961_03875) | 725602..726303 | - | 702 | WP_003688414.1 | lactate utilization protein C | - |
| OE961_RS03880 (OE961_03880) | 726300..727079 | - | 780 | WP_003688416.1 | (Fe-S)-binding protein | - |
| OE961_RS03885 (OE961_03885) | 727227..728768 | + | 1542 | WP_003701286.1 | MDR family MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15306.65 Da Isoelectric Point: 6.0798
>T260546 WP_003691083.1 NZ_CP107223:723583-724002 [Neisseria gonorrhoeae]
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
MILLDTNVISEPLRPQPNERVVAWLDSLILEDVYLSAITVAELRLGVALLLNGKKKNVLHERLEQSILPLFAGRILPFDE
PVAAIYAQIRSYAKTHGKEIAAADGYIAATAKQHSLTVATRDTGSFFAADVAVFNPWHD
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|