Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | spoIISABC/SpoIISA-SpoIISB |
| Location | 1330626..1331542 | Replicon | chromosome |
| Accession | NZ_CP107079 | ||
| Organism | Bacillus velezensis strain LT-2 | ||
Toxin (Protein)
| Gene name | spoIISA | Uniprot ID | - |
| Locus tag | OD347_RS07070 | Protein ID | WP_088612661.1 |
| Coordinates | 1330796..1331542 (-) | Length | 249 a.a. |
Antitoxin (Protein)
| Gene name | spoIISB | Uniprot ID | I2HQ14 |
| Locus tag | OD347_RS07065 | Protein ID | WP_003154807.1 |
| Coordinates | 1330626..1330796 (-) | Length | 57 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OD347_RS07030 | 1327536..1327868 | + | 333 | WP_088612657.1 | XkdW family protein | - |
| OD347_RS07035 | 1327868..1328032 | + | 165 | WP_014470494.1 | XkdX family protein | - |
| OD347_RS07040 | 1328087..1328884 | + | 798 | WP_088612658.1 | phage portal protein | - |
| OD347_RS07045 | 1328938..1329201 | + | 264 | WP_088612659.1 | hemolysin XhlA family protein | - |
| OD347_RS07050 | 1329215..1329478 | + | 264 | WP_013351965.1 | phage holin | - |
| OD347_RS07055 | 1329492..1330370 | + | 879 | WP_088612660.1 | N-acetylmuramoyl-L-alanine amidase | - |
| OD347_RS07060 | 1330404..1330529 | - | 126 | WP_003154809.1 | hypothetical protein | - |
| OD347_RS07065 | 1330626..1330796 | - | 171 | WP_003154807.1 | type II toxin-antitoxin system SpoIISB family antitoxin | Antitoxin |
| OD347_RS07070 | 1330796..1331542 | - | 747 | WP_088612661.1 | type II toxin-antitoxin system SpoIISA family toxin | Toxin |
| OD347_RS07075 | 1331651..1332649 | - | 999 | WP_013351968.1 | inorganic phosphate transporter | - |
| OD347_RS07080 | 1332662..1333279 | - | 618 | WP_003154804.1 | DUF47 domain-containing protein | - |
| OD347_RS07085 | 1333564..1334880 | - | 1317 | WP_088612662.1 | amino acid permease | - |
| OD347_RS07090 | 1335202..1336152 | + | 951 | WP_013351970.1 | ring-cleaving dioxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 249 a.a. Molecular weight: 29084.56 Da Isoelectric Point: 4.6839
>T260519 WP_088612661.1 NZ_CP107079:c1331542-1330796 [Bacillus velezensis]
MLLFYQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFTAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRQYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
MLLFYQIMVWTMAAALILYVYASWRYEAKVKEKMFAIRKTWYLLFVVGAMVYWTYDPESLFTAWRQYLIVAVCFALIDAF
IFLSAYIKKLAGNELETDTREILEENNEMLHSYLEKLKTYQYLLKNEPIHVYYGSTEAYAEGISRLLAAYAEKMNVTASL
CDYSAQSDKDRLTEHMPDAADVQSRLNRKDVYYDQKGRLVLIPFTVQNRQYVIKLTSENLLTEFDYLLFTSLTSIYDLML
PIEEEGDG
Download Length: 747 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|